KEGG   Caldilinea aerophila: CLDAP_40970Help
Entry
CLDAP_40970       CDS       T01797                                 

Definition
putative acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
cap  Caldilinea aerophila
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CLDAP_40970
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLDAP_40970
   00650 Butanoate metabolism
    CLDAP_40970
  Amino acid metabolism
   00360 Phenylalanine metabolism
    CLDAP_40970
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CLDAP_40970
   00622 Xylene degradation
    CLDAP_40970
   00621 Dioxin degradation
    CLDAP_40970
Enzymes [BR:cap01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CLDAP_40970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5118576..5119403)
Genome map
AA seq 275 aa AA seqDB search
MELVMLAGIDPNSEGLARARSLGVEASHAGIDAILEAPEIRIVFDATSAKAHVRHAKALR
KTGRIAIDLTPAARGPYVVPPVNLGEHLNAPNVNLITCGGQATIPLVYAVSRVTPVRYAE
MVSTVASRSAGPGTRQNIDEFTFTTARGLEVIGGAAQGKAIIILNPAEPPILMRNTVYVV
PATEFDEGAIFSSIAQMVAEVQRYVPGYRLKSRPVIEYRETPWGKRPVVIMLLEVEGAGD
FLPPYAGNLDIMTASARRVGELFAQHLLSTEEVMA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggagctggtgatgctggccggtatcgatccgaactctgaggggttggcgcgtgccaga
agcctgggcgtcgaggccagccacgcaggcattgatgccatcctggaagctccagagatt
cgcatcgtcttcgatgccaccagcgccaaagcacacgtgcgtcatgccaaagcgttgcgc
aagacaggacgcatcgccatcgatctgacgccggccgcgcgcggcccctacgtggttccg
ccggtgaatctgggcgaacatttgaatgcacccaatgtcaacctgatcacatgtgggggg
caggctaccatcccgctggtctatgccgtcagtcgcgtgacgccggttcgttacgccgag
atggtgagcacggttgccagtcgctcggcaggaccgggtacgcgccagaacattgacgaa
ttcaccttcaccacggcgcgcgggctggaggtcatcggcggcgctgcccagggcaaggcg
attatcatcctcaacccggccgagccgcccattttgatgcgcaacaccgtctatgtcgtc
cctgcaaccgaattcgatgaaggggctatcttttcttccattgcgcaaatggtagcagag
gtgcagcgttacgtacccggttatcggttgaaaagtcggcctgtgatcgaatatcgagaa
acaccgtggggaaaacggccggtagtcatcatgttgttggaggtagagggcgccggtgat
tttctccctccctacgcaggcaatctcgacatcatgacggcttcggcgcgacgtgtcggc
gagctgtttgcccaacacttgctgtctaccgaggaggtcatggcatga

DBGET integrated database retrieval system