KEGG   Corynebacterium aurimucosum: cauri_0285Help
Entry
cauri_0285        CDS       T00887                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
car  Corynebacterium aurimucosum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:car00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cauri_0285 (gpmA)
   01230 Biosynthesis of amino acids
    cauri_0285 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cauri_0285 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    cauri_0285 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cauri_0285 (gpmA)
Enzymes [BR:car01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     cauri_0285 (gpmA)
Exosome [BR:car04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   cauri_0285 (gpmA)
  Exosomal proteins of melanoma cells
   cauri_0285 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
323505..324266
Genome map
AA seq 253 aa AA seqDB search
MLVFMSNGKLILLRHGQSEWNESNQFTGWVDVNLTAKGEGEAKRGGELLKEQGILPNVVY
TSLLRRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETKDKYGEEQFMAWR
RSYGTPPPELEDGAEYSQAGDPRYANLDQVPRTECLKDVVERFVPYFEEEILPRAKKGET
VLIAAHGNSLRALVKHLDQISDEEIAGLNIPTGIPLVYEITEDGSVVNPGGTYLDPEAAA
AGAAAVAAQGGKN
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgctggtgtttatgagtaacggaaagctgattctacttcgacacggacagtccgaatgg
aacgagtccaaccagttcaccggttgggttgatgtcaacctcaccgccaagggtgagggt
gaggccaagcgtggcggcgagctgctcaaggaacagggcatcctgccgaacgttgtctac
acctccctgctgcgccgcgccatccgcaccgccaacatcgcgctcaacgctgcggaccgc
cactggatcccggtcgtgcgtgactggcgtttgaacgagcgccactacggtgccctgcag
ggcctcaacaaggccgagaccaaggacaagtacggcgaggagcagttcatggcatggcgc
cgttcctacggcaccccgccgccggagctggaggatggcgccgagtactcccaggccggt
gacccgcgctacgccaacctggatcaggttccgcgcaccgagtgcctgaaggacgtcgtc
gagcgcttcgttccttatttcgaggaggagatcctcccgcgcgccaagaagggtgaaacc
gttctcatcgccgcacacggcaactccctgcgtgcgctggtcaagcacttggatcagatc
tccgatgaggagattgccggcctcaacatcccgactggcatcccactggtctacgagatc
accgaggacggttccgtggtgaaccccggcggcacctacctggatccggaagctgccgct
gccggcgctgccgccgtggctgctcagggtggaaagaactaa

DBGET integrated database retrieval system