KEGG   Corynebacterium aurimucosum: cauri_0285Help
Entry
cauri_0285        CDS       T00887                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
car  Corynebacterium aurimucosum
Pathway
car00010  Glycolysis / Gluconeogenesis
car00260  Glycine, serine and threonine metabolism
car00680  Methane metabolism
car01100  Metabolic pathways
car01110  Biosynthesis of secondary metabolites
car01120  Microbial metabolism in diverse environments
car01130  Biosynthesis of antibiotics
car01200  Carbon metabolism
car01230  Biosynthesis of amino acids
Module
car_M00002  Glycolysis, core module involving three-carbon compounds
car_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:car00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cauri_0285 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    cauri_0285 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cauri_0285 (gpmA)
Enzymes [BR:car01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     cauri_0285 (gpmA)
Membrane trafficking [BR:car04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    cauri_0285 (gpmA)
Exosome [BR:car04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   cauri_0285 (gpmA)
  Exosomal proteins of melanoma cells
   cauri_0285 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACP31884
UniProt: C3PKE8
Position
323505..324266
Genome map
AA seq 253 aa AA seqDB search
MLVFMSNGKLILLRHGQSEWNESNQFTGWVDVNLTAKGEGEAKRGGELLKEQGILPNVVY
TSLLRRAIRTANIALNAADRHWIPVVRDWRLNERHYGALQGLNKAETKDKYGEEQFMAWR
RSYGTPPPELEDGAEYSQAGDPRYANLDQVPRTECLKDVVERFVPYFEEEILPRAKKGET
VLIAAHGNSLRALVKHLDQISDEEIAGLNIPTGIPLVYEITEDGSVVNPGGTYLDPEAAA
AGAAAVAAQGGKN
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgctggtgtttatgagtaacggaaagctgattctacttcgacacggacagtccgaatgg
aacgagtccaaccagttcaccggttgggttgatgtcaacctcaccgccaagggtgagggt
gaggccaagcgtggcggcgagctgctcaaggaacagggcatcctgccgaacgttgtctac
acctccctgctgcgccgcgccatccgcaccgccaacatcgcgctcaacgctgcggaccgc
cactggatcccggtcgtgcgtgactggcgtttgaacgagcgccactacggtgccctgcag
ggcctcaacaaggccgagaccaaggacaagtacggcgaggagcagttcatggcatggcgc
cgttcctacggcaccccgccgccggagctggaggatggcgccgagtactcccaggccggt
gacccgcgctacgccaacctggatcaggttccgcgcaccgagtgcctgaaggacgtcgtc
gagcgcttcgttccttatttcgaggaggagatcctcccgcgcgccaagaagggtgaaacc
gttctcatcgccgcacacggcaactccctgcgtgcgctggtcaagcacttggatcagatc
tccgatgaggagattgccggcctcaacatcccgactggcatcccactggtctacgagatc
accgaggacggttccgtggtgaaccccggcggcacctacctggatccggaagctgccgct
gccggcgctgccgccgtggctgctcagggtggaaagaactaa

DBGET integrated database retrieval system