KEGG   Corynebacterium aurimucosum: cauri_0462Help
Entry
cauri_0462        CDS       T00887                                 

Gene name
alr
Definition
alanine racemase (EC:5.1.1.1)
Orthology
K01775  
alanine racemase [EC:5.1.1.1]
Organism
car  Corynebacterium aurimucosum
Pathway
D-Alanine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:car00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    cauri_0462 (alr)
Enzymes [BR:car01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     cauri_0462 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
497164..498261
Genome map
AA seq 365 aa AA seqDB search
MLKTTVDLNAIAHNVARVKEAVAPARLMCVVKADAYAHGIERCAPVMAQAGADAFGVATL
AEAVALRKVIDNLPIAAWLWEPTEDLAPALAADIQIGIPSLAHAQALIAAETPTEAFVMV
ETGMHRSGVDKHVWEETFRLLADAPHITVLGLMSHFACADEPEHPHNDHQESEFRQALAL
AREVGLECPLNHLANSPAALTRPSARFEQVRVGLALYGLEPVAGLDHGLEPAMTWEASVV
AVKPISAGESTCYGLTWTAESERELATVSVGYADGLPRAFQGALQVGIGGELYPQVGRVC
MDQIVVDLGSNPHGVRAGDTAVIFGRGGMSATGLAEAAGTINYEVVCRPTGRTERTYREG
ASDAQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaccaccgttgacctcaacgctattgcccacaatgttgcccgcgtgaaggag
gcggtggccccggcccgcctcatgtgcgtggtcaaggcggatgcctatgcccacggcatc
gagcgctgcgccccggtcatggcgcaggctggggcggatgccttcggggtggccaccttg
gccgaggcagtcgcattgcggaaggtcatcgacaacctccccatcgctgcttggctgtgg
gagccgacggaggacctggccccagcccttgccgctgatatccagatcggcatcccgtcg
ctggcgcacgcccaagcgctcatcgccgccgagaccccaaccgaagccttcgtgatggtg
gagacggggatgcaccgctcgggagtcgacaagcatgtgtgggaggagaccttccgcctg
cttgccgacgccccccacatcaccgtcctaggcctcatgtcccatttcgcctgcgctgat
gagccggaacacccgcacaatgatcatcaggaatcggagttccgccaggccctagcgctt
gcccgtgaggtggggctggagtgtccgctgaaccacctggcgaactcgcccgcggcgttg
acccgcccctcagctcgtttcgagcaggtgcgcgtcggtctggccctgtatgggcttgaa
ccagtcgccgggctcgaccatggactggaacccgccatgacgtgggaggcatccgtcgtc
gcagtgaagccgatttcggcgggggagtccacatgctacggcctgacctggacagcggag
agtgagcgcgagctcgccaccgtcagcgtgggttatgccgatggtctgccgcgtgccttt
cagggggcgctgcaggtaggcattggtggcgagctctacccgcaggtggggcgggtctgt
atggaccagattgtcgtcgaccttggctctaacccccacggcgtgcgcgccggggacacc
gccgttatcttcgggcgcggcggtatgagcgccactggattggccgaggcagccgggacc
atcaactatgaagtggtgtgccgccccaccgggcgcaccgagcgtacataccgcgaagga
gctagcgatgcgcagtga

DBGET integrated database retrieval system