KEGG   Corynebacterium aurimucosum: cauri_0635Help
Entry
cauri_0635        CDS       T00887                                 

Gene name
adhC
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
car  Corynebacterium aurimucosum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:car00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    cauri_0635 (adhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cauri_0635 (adhC)
  Lipid metabolism
   00071 Fatty acid degradation
    cauri_0635 (adhC)
  Amino acid metabolism
   00350 Tyrosine metabolism
    cauri_0635 (adhC)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    cauri_0635 (adhC)
   00626 Naphthalene degradation
    cauri_0635 (adhC)
Enzymes [BR:car01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     cauri_0635 (adhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(688224..689342)
Genome map
AA seq 372 aa AA seqDB search
MSDTITIRGAVLERSGDERPYADSKPITVSELELTAPGEGEILVKITAAGLCHSDLSVVN
NNRPRPLPMLLGHESAGIVEEIGPGVTNVKVGDHVVMTFLPRCGECAGCKTDGKMPCEVG
SKTNNEGTLIRGTRHLTRNGETVQHHLGVSGFATHAVVSELSVVPVGSDVPADIAAILGC
AILTGGGAVLNEIDPKPEDSIAVVGLGGVGMAAIITAAALGVKEIVGIDMQKDKCEKALE
IGATSAMTPQEAEESGKKFTAVVEAAGHPKALETAYKVTAPGGLTVTVGLPAPGSTITID
PLVMTGEARRVHGCYLGSSVPSKDIPKYEQLWREGKLNAEALISDHIKLEDINTAMDRLS
DGAALRQIIEFD
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacacgattaccattcgcggcgccgtcctggagcgctccggcgatgagcgtccc
tacgccgactccaagcccattaccgtgagcgagctcgagctcaccgcccccggcgagggc
gagattctggtcaagatcaccgccgctggcctctgccactccgacctctccgtggtcaac
aacaaccgcccgcgcccgctgccgatgctgctgggccacgagtccgccggcatcgtcgag
gaaattggccccggcgttaccaacgtcaaggttggcgaccacgtagtcatgactttcctc
ccgcgctgcggcgagtgcgccggctgcaagaccgacggcaagatgccctgtgaggtcggc
tccaagaccaacaacgagggcaccctcattcgcggcacccgccacctcacccgcaacggt
gagacggtccagcaccacctcggcgtttctggctttgctacccacgcggtggtttctgag
ctgtccgtcgtaccggtgggctccgatgtcccggcggacatcgccgctatcctcggctgc
gccatcctcaccggtggcggcgccgtgctcaacgagatcgatccaaagccggaggacagc
atcgccgtcgtcggcctcggtggcgtgggcatggccgccatcatcaccgccgctgccctc
ggcgtgaaggagatcgtgggcatcgacatgcagaaggacaagtgcgaaaaggccctcgaa
atcggcgccacctccgccatgaccccgcaggaagctgaggagtccggcaagaagttcacc
gccgtcgtggaggccgccggccacccgaaggccctagaaaccgcatacaaggtcaccgca
ccgggcggcctgaccgttaccgttggcctgccagcaccgggctccaccatcaccatcgac
ccgctcgtgatgaccggtgaggcacgccgcgtgcacggctgctacctgggttcctccgtt
ccgtcgaaggacattccgaagtacgagcagctgtggcgtgagggcaagctcaacgctgag
gccctgatctccgatcacatcaagctcgaggacatcaacaccgccatggaccgcctgtca
gacggtgcggccctgcgccagatcatcgaattcgactaa

DBGET integrated database retrieval system