KEGG   Corynebacterium aurimucosum: cauri_0793Help
Entry
cauri_0793        CDS       T00887                                 

Gene name
cysQ
Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
car  Corynebacterium aurimucosum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:car00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    cauri_0793 (cysQ)
Enzymes [BR:car01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     cauri_0793 (cysQ)
Transfer RNA biogenesis [BR:car03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    cauri_0793 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(866733..867491)
Genome map
AA seq 252 aa AA seqDB search
MTVEISDSRLTNSLADGCGEILKGVRNGGLLRGLALGDAGDEAAQEWISRVLEQHRPKDG
VLSEEAADDLSRLKKDRVWIIDPLDGTKEFATGRQDWAVHIALVENGTPIHAAVGMPDMG
VTFKSSDVRAVTGPLSKKFVVSRNRPPKVADYVAEKMSFETVGVGSAGAKAIHVLLGDYD
GYIHAGGQYEWDQAAPVGVALAAGLHCSRLDGSPIKFNNEDTFIPDLLICRPELAEEILE
HAAAYAEANGGY
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttgagatttctgattcccgtctaaccaactccctcgccgatggctgcggcgaa
atactcaaaggcgtgcgcaacggtggcctgctgcgcggcttggcgctgggtgatgccggc
gatgaggccgctcaggagtggatctcccgcgtccttgagcagcaccgtcccaaggacggc
gtcctgtcggaagaggctgccgatgacttaagccgtttgaagaaggaccgcgtgtggatc
attgacccgctcgacggcacgaaggagtttgctaccggccgccaggactgggccgtccac
atcgctctggtcgaaaacggcacccccatccacgcggccgtcggcatgccggacatgggc
gtgacctttaagtcctccgacgtgcgcgcggtaaccggcccgctgtcaaagaagttcgtg
gtttcccgcaaccgtccgccgaaggtggcggattacgtcgcggagaagatgagctttgag
accgtcggcgtgggctccgcaggtgcgaaggcgatccacgtgctcttgggcgactatgac
ggctacatccatgccggcggccagtacgagtgggaccaagccgccccggtgggcgtggct
ttggccgcgggcctgcactgttcacgcctggatggctcccccatcaagttcaataacgag
gacaccttcatcccggatcttttgatctgccgcccggagctggcagaggagattctggaa
cacgccgccgcctacgcggaggccaacggcgggtactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system