KEGG   Corynebacterium aurimucosum: cauri_0833Help
Entry
cauri_0833        CDS       T00887                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
car  Corynebacterium aurimucosum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:car00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    cauri_0833 (galU)
   00052 Galactose metabolism
    cauri_0833 (galU)
   00500 Starch and sucrose metabolism
    cauri_0833 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    cauri_0833 (galU)
Enzymes [BR:car01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     cauri_0833 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
909911..910849
Genome map
AA seq 312 aa AA seqDB search
MELMTIAHEDSHTGIATVVVPAAGMGTRFLPATKTVPKELLPVVDTPGIELIAEEAASVG
AQRLAVITAPNKQEVMRHFEEFPDLVETLDARGKDEQVAKVKRAAQLIHPISVEQEKPLG
LGHAVGLAESVLEDDEEFFAVMLPDDIVLPATVMGEMARVRAALGGSVLCAFEVSREETY
NYGVFDVEDTNAPGVKKVVGMVEKPDPADAPSNLVATGRYLLDRKIFDALRRIKPGKGGE
LQLTDAIELLIKEGHPVHVVVHQGKRHDLGNPGGYIPANVDFGLRDEKYGPALYKAIKKI
VEDYEEENGLKD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtggaacttatgactattgcacacgaggattcccatactgggatcgccacggtcgttgtc
cccgctgctggcatgggcacccgctttttgccagccaccaagaccgtgccgaaggagctg
ctccccgtcgttgatacgccgggtattgagcttattgcagaagaggccgcttccgtgggc
gcccagcgcctcgcggtgattaccgcaccgaacaaacaagaagtgatgcggcacttcgag
gagtttcctgatctagttgaaacccttgacgcccgcggcaaagacgagcaggtggccaag
gttaagcgcgctgctcagttgattcacccaatttccgtagagcaggaaaagcccttgggt
ctggggcacgcagtgggcttggcggaatccgtgctggaggatgacgaagaattcttcgcc
gtcatgttgccggatgacatcgtcctgcccgctaccgtcatgggcgagatggcccgtgtt
cgcgccgccctgggtggcagcgttctgtgtgcttttgaagtctcgcgcgaggagacctat
aactacggcgtgtttgatgtcgaggacaccaacgcgccgggcgtgaagaaggtcgtgggc
atggtggagaagccggatccagctgatgcaccttcgaacctcgtggccactgggcgctac
ctgctcgacaggaagatttttgacgcccttcgccgcatcaaaccaggtaaaggtggggag
ctgcagttgaccgatgccatcgagctcctcattaaggaaggccaccccgttcacgtcgta
gtccaccaaggcaagcgccacgacctgggtaacccgggcggctatatcccggccaacgtg
gactttggtctgcgcgatgagaaatacggtcccgcgctctacaaggcgattaagaagatt
gtggaggactacgaagaagaaaacggactgaaggactaa

DBGET integrated database retrieval system