KEGG   Corynebacterium aurimucosum: cauri_0851Help
Entry
cauri_0851        CDS       T00887                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
car  Corynebacterium aurimucosum
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:car00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    cauri_0851 (ispE)
Enzymes [BR:car01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     cauri_0851 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
929135..930073
Genome map
AA seq 312 aa AA seqDB search
MSKPVNESPQLWQARAHAKVNLHLGVGEARADGFHELATVFQSLDVHDRVNYRWGEGCAV
EVTGNHAKGVPASTENLAWRAVELVAQNLMLPAAGTLTMEKNIPAAGGMAGGSADAAAAL
LLANQALSKEFGREPLSTERLYELAAELGSDVPFTLMGGTALGRGRGELLTPMLSRGRYI
WAIITNAEGLSTPSVFRKLDELRAAGRGSTPHLDTEAVGQALVGGNPRELAAVMHNDLQP
AALSLRPDLRKILETGEAAGALKGIVSGSGPTCAFLCEDEETAQEVVAQVCADNRGTRGL
VTRGPATGATLV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaccagtaaacgagtccccgcagctctggcaggcacgcgcccacgccaaggtc
aatctgcatctcggtgtgggggaggctcgcgcggatggtttccacgagctggccaccgtg
ttccagtccctcgatgtacacgatcgcgtgaactaccgctggggcgaaggctgcgccgtg
gaggtcactggcaaccatgcgaagggcgttccggcatcaaccgagaacctggcatggcgc
gcggtggagctggtggcacagaatctgatgctgccggctgctggaacgctcacgatggaa
aagaacatcccggccgccggcggaatggcgggcggctctgccgatgccgccgcggccctg
ttgttggccaaccaggctctaagcaaggagtttggccgcgagcctctcagcacggaaagg
ctctatgagctcgccgcggagctcggctccgacgttccttttaccctcatgggtggcacg
gcgttggggcgcgggcgcggcgaactcttgacgccgatgctctcgcgcgggcgatatatc
tgggcaatcatcaccaatgcggagggtttgtccacgccctctgtcttccgaaagctggat
gagctgcgcgctgccggacgcggaagcaccccacacctcgacacggaagccgtgggacaa
gcgcttgtaggcggcaatccccgcgagctcgccgcggtgatgcacaacgacctccagccg
gcagccctctcgctacgcccagacctgcgcaagatcctcgagactggtgaagctgccggt
gccctcaagggaattgtctccggctcggggcccacctgcgccttcctctgtgaagacgag
gagactgcccaggaagtggtggctcaggtctgcgccgataaccgcggtactcgtggattg
gtgacccgcggccctgccaccggcgcaacactggtctag

DBGET integrated database retrieval system