KEGG   Corynebacterium aurimucosum: cauri_0868Help
Entry
cauri_0868        CDS       T00887                                 

Gene name
fadA1
Definition
(GenBank) acyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
car  Corynebacterium aurimucosum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:car00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    cauri_0868 (fadA1)
   00630 Glyoxylate and dicarboxylate metabolism
    cauri_0868 (fadA1)
   00640 Propanoate metabolism
    cauri_0868 (fadA1)
   00650 Butanoate metabolism
    cauri_0868 (fadA1)
  Lipid metabolism
   00071 Fatty acid degradation
    cauri_0868 (fadA1)
   00072 Synthesis and degradation of ketone bodies
    cauri_0868 (fadA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    cauri_0868 (fadA1)
   00310 Lysine degradation
    cauri_0868 (fadA1)
   00380 Tryptophan metabolism
    cauri_0868 (fadA1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    cauri_0868 (fadA1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    cauri_0868 (fadA1)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    cauri_0868 (fadA1)
Enzymes [BR:car01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     cauri_0868 (fadA1)
Exosome [BR:car04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   cauri_0868 (fadA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
948612..949880
Genome map
AA seq 422 aa AA seqDB search
MRAEIDPQGWRSAQSIGTIRVNFVQFGERNMDIVIVGAARTPFGKLLGGLAALPATELGS
HAIAAALAQAQVNPDDVDAVIFGQVLQAGVGQNPTKQAALGAGISPNAHTTTVNKVCLSG
LTAIIDASRLLRSGEATVVVAGGMESMSNAPHLLPQSRKGKKFGSVELLDHMEHDGLRAA
DLGISMGSLSEKYAERYPATRQEQDRCAALSHQRALQASEEGLFDTEIAPITVASRHDEI
TFSRDEGIREGVTEESLAGLRPAFEPEGGITAGNSSPITDGAAAVVLTTREHAEKKGLPI
MAVLRAPGQVAGPDSSLQEQPARALLQALERQGWSAKDLDHIEINEAFAAVVVHSARVLG
IHPDDVNPQGGAIALGHPIGASGARLVVHAAHLLAESHARRAGVTLCGGGGQGEALLLEA
VN
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcgagctgagattgacccacaagggtggcgcagcgcacaatccatcggtacgattcgg
gttaacttcgtacagtttggagagcgaaatatggacatcgttattgtgggcgccgcccga
acgcccttcggcaagttgcttggcggccttgcggccttgcccgcaacggagctcggctcc
catgccatcgctgctgcgctcgcgcaagcgcaggtcaaccccgacgacgttgatgcggtg
atcttcggacaagtcttgcaggcaggtgtggggcaaaaccccacgaagcaggcagcactg
ggggcaggaatttccccgaacgcgcacaccacaacggtcaacaaggtctgcctgtccggt
ctgaccgcgattatcgacgcctcccggctcctgcgctccggcgaagccacggtggtagtg
gccgggggaatggagtcgatgtcgaatgctccccacctgctgccgcagtcgcgcaaggga
aagaaattcggctctgttgagcttctcgatcacatggagcacgatggcctgcgggcagcg
gacctcgggatttccatgggctcgctgtcggagaagtatgccgagcgctatccggccacc
cgccaggaacaagaccgctgcgccgcgctgtcccaccagcgcgctctgcaggcgagcgag
gagggactctttgacacggagatcgctccgatcaccgtagcgagccggcacgacgagatc
accttctcgcgcgatgaaggcatccgggagggagtcaccgaagaatccttggctgggctg
cgtccggcctttgagcctgaaggaggcataacggccggaaattcttcacccatcacggat
ggggctgcggccgtcgttctcaccacccgcgaacatgcggagaaaaaagggttgccgatc
atggcggtcctgcgcgcgcctgggcaagtagccggcccggattcttcgctgcaggagcag
cccgctcgtgcccttcttcaagccctggaacggcagggctggagtgcaaaggacctcgac
cacatcgagatcaatgaggccttcgccgcggtagtggtgcattccgcgagggtccttgga
atccaccccgatgacgtgaatccgcagggcggagcgattgccctggggcaccctatcggt
gcttccggtgcacggctcgtggtgcatgcggcgcacctcttggcagaatcccatgcccgc
cgcgccggggtcacgttgtgcggcggcggtggacaaggtgaagccctgttgcttgaggct
gtgaactaa

DBGET integrated database retrieval system