KEGG   Corynebacterium aurimucosum: cauri_0869Help
Entry
cauri_0869        CDS       T00887                                 

Gene name
echA3
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
car  Corynebacterium aurimucosum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:car00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    cauri_0869 (echA3)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    cauri_0869 (echA3)
   00650 Butanoate metabolism
    cauri_0869 (echA3)
  Lipid metabolism
   00071 Fatty acid degradation
    cauri_0869 (echA3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    cauri_0869 (echA3)
   00310 Lysine degradation
    cauri_0869 (echA3)
   00360 Phenylalanine metabolism
    cauri_0869 (echA3)
   00380 Tryptophan metabolism
    cauri_0869 (echA3)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    cauri_0869 (echA3)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    cauri_0869 (echA3)
   00281 Geraniol degradation
    cauri_0869 (echA3)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    cauri_0869 (echA3)
   00627 Aminobenzoate degradation
    cauri_0869 (echA3)
   00930 Caprolactam degradation
    cauri_0869 (echA3)
Enzymes [BR:car01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     cauri_0869 (echA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
949918..950979
Genome map
AA seq 353 aa AA seqDB search
MTNEIISEVRGHAGVLTLNRPKAINALNQTMIDEMTAVLQEWQDDDRVKLVILRGAGERG
LCAGGDVAALYHDALEGGTAGAHFWKTEYELNYLISTYSKPYVALMEGIVLGGGIGVSAH
ASHRIVSEDSRIGMPEVGIGYSPDAGGSYLLSRAADRLGRHLAYTAIHVGAAEAIDTGFA
DYFVPKDKLDALVEQLVESGEPADIEKFSEEVGPGFGEDRAEMVEVYAAETAEETLARLQ
ERAAAGGEGHWAAKATKRMSLNSPLGIRVTEESLNRNASMSFAETLTQEFWMSVNMQKHK
EFVEGIRAQIVDKDRNPSWEYESIGAVPPDVVASILEHSEGNVEAPTFDTSEN
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatgagattattagcgaagttcgtggacacgccggcgtgctcacgctcaatcgg
cccaaggccattaacgcgctgaaccagacgatgattgatgagatgacggcggtgcttcag
gagtggcaggatgatgaccgcgtcaagctcgttattctccgcggcgctggcgaacgcggg
ctatgcgcgggcggtgacgtcgcagccttgtaccacgatgccctggaaggcggaaccgca
ggcgcccatttctggaagacggaatacgagctgaactatctgatctccacctattccaag
ccttacgtggcgctcatggaaggcatcgtgctgggcggtggaatcggcgtgtcggcgcac
gcctcgcaccgcatcgtgagtgaggattcacgcatcggcatgccggaagtaggaattggg
tattcgcccgatgccggcggttcctacctgctgtcccgagctgcagatcgccttggccgc
cacctggcctataccgcgatccacgtgggcgccgcggaggcgatcgataccggttttgcg
gattacttcgtgcccaaggacaagctcgacgcgttggtagagcagctggtggagtcgggg
gaaccggcagacatcgagaagttttccgaagaggtgggacccggcttcggggaggatcgc
gccgaaatggttgaggtctatgccgcggagactgccgaggaaaccttggcccggctacag
gagcgcgcagccgccgggggtgaaggccactgggccgcgaaggctaccaagcggatgagc
cttaactccccactgggaatccgcgttaccgaagaatccctgaaccgcaatgcgtcgatg
agcttcgcagaaaccttgacgcaagaattctggatgtccgtgaacatgcaaaagcacaag
gaattcgtcgagggtatccgcgcgcagatcgttgataaggaccgtaacccttcctgggaa
tacgagtccatcggcgccgtcccaccggacgtcgtggcgtctattctcgaacacagcgaa
ggcaatgtggaagctcccacattcgatacctccgaaaactag

DBGET integrated database retrieval system