KEGG   Corynebacterium aurimucosum: cauri_0870Help
Entry
cauri_0870        CDS       T00887                                 

Gene name
echA1
Definition
(RefSeq) enoyl-CoA hydratase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
car  Corynebacterium aurimucosum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:car00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    cauri_0870 (echA1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    cauri_0870 (echA1)
   00650 Butanoate metabolism
    cauri_0870 (echA1)
  Lipid metabolism
   00071 Fatty acid degradation
    cauri_0870 (echA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    cauri_0870 (echA1)
   00310 Lysine degradation
    cauri_0870 (echA1)
   00360 Phenylalanine metabolism
    cauri_0870 (echA1)
   00380 Tryptophan metabolism
    cauri_0870 (echA1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    cauri_0870 (echA1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    cauri_0870 (echA1)
   00281 Geraniol degradation
    cauri_0870 (echA1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    cauri_0870 (echA1)
   00627 Aminobenzoate degradation
    cauri_0870 (echA1)
   00930 Caprolactam degradation
    cauri_0870 (echA1)
Enzymes [BR:car01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     cauri_0870 (echA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
951048..951812
Genome map
AA seq 254 aa AA seqDB search
MAILTEKRGRVALITLNRPEALNALNNDTMLEVTHAVQEFDADGEVGAIVITGSDKAFAA
GADIKEMSSKTATEMYTADWFAGWDVLTRARTPIIAAVNGYALGGGCELAMMCDFIIAGD
KAKFGQPEVNLGVTPGMGGSQRLTRAIGKAKAMEMCLTGRMMAAEEAERSGLVARVVPAD
ELLDSALETAQLIASKSFVATSQIKEQVNAVDELSLSQGIQFERRTFHALFSSHDQKEGM
AAFVEKRDPDFKHA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcaattcttactgaaaagcgcggccgcgtcgcactcatcacccttaaccgtccggaa
gcactcaacgcgctgaacaacgacaccatgcttgaggtcacgcacgcggtccaggaattc
gacgccgatggagaagtaggcgcaatcgttattaccggttccgacaaggcctttgccgcc
ggcgcagatatcaaggagatgtcttcgaagacggcgacggagatgtacaccgcggactgg
ttcgccggctgggacgtcctcacgcgcgctcgcacgcccattatcgcggcggtcaacggc
tacgcgcttggcggcggttgcgagctagccatgatgtgtgacttcattatcgccggtgac
aaggccaagtttggccagcccgaggtcaacctcggcgttaccccgggcatgggcggctcc
cagcgcctaacccgtgccatcggaaaggccaaggcaatggagatgtgcctgaccggccgc
atgatggcagcggaggaagcagagcgctctggtctcgtggcccgcgtggttcccgccgac
gagctcctcgattccgcgctagaaaccgcgcagctcatcgcctcgaagtccttcgtcgca
acgtcccagatcaaggaacaagtcaatgccgtggatgagctctcgctgtcccagggcatc
cagtttgagcgccgcaccttccacgcactcttctcatcccacgaccaaaaggaaggaatg
gcagccttcgtggagaagcgtgacccagacttcaagcatgcttaa

DBGET integrated database retrieval system