KEGG   Corynebacterium aurimucosum: cauri_0870Help
Entry
cauri_0870        CDS       T00887                                 

Gene name
echA1
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
car  Corynebacterium aurimucosum
Pathway
car00071  Fatty acid degradation
car00280  Valine, leucine and isoleucine degradation
car00310  Lysine degradation
car00360  Phenylalanine metabolism
car00362  Benzoate degradation
car00380  Tryptophan metabolism
car00410  beta-Alanine metabolism
car00627  Aminobenzoate degradation
car00640  Propanoate metabolism
car00650  Butanoate metabolism
car00903  Limonene and pinene degradation
car01100  Metabolic pathways
car01110  Biosynthesis of secondary metabolites
car01120  Microbial metabolism in diverse environments
car01130  Biosynthesis of antibiotics
car01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:car00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    cauri_0870 (echA1)
   00650 Butanoate metabolism
    cauri_0870 (echA1)
  Lipid metabolism
   00071 Fatty acid degradation
    cauri_0870 (echA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    cauri_0870 (echA1)
   00310 Lysine degradation
    cauri_0870 (echA1)
   00360 Phenylalanine metabolism
    cauri_0870 (echA1)
   00380 Tryptophan metabolism
    cauri_0870 (echA1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    cauri_0870 (echA1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    cauri_0870 (echA1)
   00281 Geraniol degradation
    cauri_0870 (echA1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    cauri_0870 (echA1)
   00627 Aminobenzoate degradation
    cauri_0870 (echA1)
   00930 Caprolactam degradation
    cauri_0870 (echA1)
Enzymes [BR:car01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     cauri_0870 (echA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACP32467
UniProt: C3PF63
Position
951048..951812
Genome map
AA seq 254 aa AA seqDB search
MAILTEKRGRVALITLNRPEALNALNNDTMLEVTHAVQEFDADGEVGAIVITGSDKAFAA
GADIKEMSSKTATEMYTADWFAGWDVLTRARTPIIAAVNGYALGGGCELAMMCDFIIAGD
KAKFGQPEVNLGVTPGMGGSQRLTRAIGKAKAMEMCLTGRMMAAEEAERSGLVARVVPAD
ELLDSALETAQLIASKSFVATSQIKEQVNAVDELSLSQGIQFERRTFHALFSSHDQKEGM
AAFVEKRDPDFKHA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcaattcttactgaaaagcgcggccgcgtcgcactcatcacccttaaccgtccggaa
gcactcaacgcgctgaacaacgacaccatgcttgaggtcacgcacgcggtccaggaattc
gacgccgatggagaagtaggcgcaatcgttattaccggttccgacaaggcctttgccgcc
ggcgcagatatcaaggagatgtcttcgaagacggcgacggagatgtacaccgcggactgg
ttcgccggctgggacgtcctcacgcgcgctcgcacgcccattatcgcggcggtcaacggc
tacgcgcttggcggcggttgcgagctagccatgatgtgtgacttcattatcgccggtgac
aaggccaagtttggccagcccgaggtcaacctcggcgttaccccgggcatgggcggctcc
cagcgcctaacccgtgccatcggaaaggccaaggcaatggagatgtgcctgaccggccgc
atgatggcagcggaggaagcagagcgctctggtctcgtggcccgcgtggttcccgccgac
gagctcctcgattccgcgctagaaaccgcgcagctcatcgcctcgaagtccttcgtcgca
acgtcccagatcaaggaacaagtcaatgccgtggatgagctctcgctgtcccagggcatc
cagtttgagcgccgcaccttccacgcactcttctcatcccacgaccaaaaggaaggaatg
gcagccttcgtggagaagcgtgacccagacttcaagcatgcttaa

DBGET integrated database retrieval system