KEGG   Corynebacterium aurimucosum: cauri_0989Help
Entry
cauri_0989        CDS       T00887                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
car  Corynebacterium aurimucosum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:car01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:car00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1090333..1091421
Genome map
AA seq 362 aa AA seqDB search
MTLNLFSDPIELTKALVDIPSPSHHEQAIADAVEEALRGLDQSKVEVERYGNTVCARTNR
GFESRVVLAGHIDTVPLADNVPHTMSEDGSIMYGCGTVDMKSGMAVYLNAFAQLYDSDEL
KHDLTVIAYEGEEVATEFNGLGHLQKDHPEWLHGDLALLGEPSGAIIEAGCQGTIRVRVT
AHGTRAHSARAWLGSNAAHTLAPVMLNVANYQPRDVEIDGCTYKEGLNIVHLESGVATNT
IPDEAWMFVNFRFAPDRSSEEALAHLMEVLGEHENITVEVDDIAGAALPGLGQPAARALV
DAVGGNVRAKYGWTDVARFSEMGTPAVNFGAGDPGFAHKKDEQVPVTQITEVSTALLNYL
KG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgactttaaatctcttctccgatcccatcgagctgaccaaggccctggtggatatccct
agcccttcgcaccacgagcaagcgatcgccgatgcggtcgaggaagccctgcgtggtctg
gaccagagcaaagtagaggtggaacgctacggcaacaccgtctgtgcccggacgaatcgg
ggcttcgaaagccgcgtggtcctcgccggccacatcgataccgtgcccctagccgataac
gtcccccacaccatgtcggaggacggcagcatcatgtatggctgcggcaccgtggacatg
aagtccggcatggccgtctacctcaacgcctttgcgcagctgtacgactctgatgagctc
aagcacgatctcacggtcatcgcctacgagggtgaggaggtcgccaccgaattcaacggc
ctgggccacctgcagaaggatcacccggagtggctgcatggagatctggccctgctgggc
gagccttccggcgccataatcgaggccggctgccagggcaccatccgtgtgcgcgttacc
gcccacggcacccgcgcgcactcggcccgcgcctggctcggctccaatgccgcccacacc
ttggcaccggtgatgcttaacgtggctaactaccagccgcgcgacgtggagattgacggc
tgcacctacaaggaaggcctcaatatcgttcacctcgaatccggcgtggccaccaacacc
attccggacgaggcctggatgttcgttaacttccgcttcgcccccgaccgcagctccgag
gaggcgctggcgcacctgatggaggtcctcggcgagcacgagaacatcaccgtggaggtc
gatgacatcgcgggtgcggccctgcccggtttgggccagccagcggcacgcgcgcttgtc
gacgccgtcggcggcaacgtccgcgccaagtatggttggaccgatgtggcccgtttctcc
gagatgggtaccccagccgtcaatttcggcgctggtgatccgggctttgcccacaagaag
gacgagcaagtacccgtcacccagatcaccgaagtctcgaccgcactcttgaactacctg
aagggataa

DBGET integrated database retrieval system