KEGG   Corynebacterium aurimucosum: cauri_1083Help
Entry
cauri_1083        CDS       T00887                                 

Gene name
glgB
Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
car  Corynebacterium aurimucosum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:car00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    cauri_1083 (glgB)
Enzymes [BR:car01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     cauri_1083 (glgB)
Exosome [BR:car04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   cauri_1083 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1202816..1204936)
Genome map
AA seq 706 aa AA seqDB search
MNIPASDLERLNHCRHHAPHDFYGWHDGTVRTRRPGAEAVELVTATETVAMRAVGDDIWE
APLAEEADYRLRITYPGQPAFEVADGYHFLPTLGTLDQHLIGEGRHERLWEVLGANLKSY
TTDMGVVEGTAFAVWAPNAEGVAVVGDFCGWNPTQYPMRCLGSTGIWEVFIPGVGEGECY
KFAVHGKNSPRIDKADPLAKRTIAPPETASVVARSSFKWSDEEWMSKRTGDLDVPMSVYE
LHVGSWKVGANYNTLREELIPYLIEHGFTHVELLPVAEHPFGGSWGYQVSGYYAPSARWG
SPDELRALIDELHNAGIGVFVDWVPAHFPKDEWALGRFDGQALYEHPDPRRGEQADWGTY
VFDFGRNEVRNFLVANALYWAEEFHVDGLRVDAVASMLYLDYSREEWLPNIYGGRENLEA
VQFLQETNATLNRNHPGVLTIAEESTSWPGVTAPTHEGGLGFSLKWNMGWMNDTLEYFKH
EPIHRRYHHGELTFSMVYAYSERYVLPFSHDEVVHGKGSLWERMPGDDWNKAAGLRALYG
YMFSHPGKQLMFMGQEFGQTTEWAEGHSVDWSNLEGWGNEWHHGIKRLVRDLNAVYKQQP
ALWTQDFTQDGFQWVKADDSNNNMLGYVRYGKDGSALLAVCNFSGSSVPNYDLWVPRDGE
WELLINTDDAVYQGAGNDLAHRVRSEGNHVQLHLPANSVQWYAFRG
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcccggcctcagacctcgaacgcctcaaccactgccgccaccacgcgccccat
gatttctatggttggcacgatggaaccgtccgcactcgccgccccggtgccgaagccgtc
gagctcgtcaccgccactgaaaccgtcgccatgcgcgcggttggggatgatatctgggag
gccccgctcgccgaagaagcagactaccgcctgcgtatcacctacccgggccagcccgcc
ttcgaggtagcggatggctaccacttcctgcctaccctgggcaccttggatcagcacctc
atcggcgagggccgccacgagcgcttgtgggaagtgctcggtgccaacctcaagagctat
accaccgacatgggcgtagtcgaaggcaccgcgtttgccgtgtgggcgcccaacgcggag
ggcgtggccgtggtcggtgacttctgcggctggaaccctacccaataccccatgcgttgc
cttggctccacgggcatttgggaggtcttcatccccggtgtgggcgaaggcgagtgctat
aagtttgcggtccacggcaagaactctccgcgcatcgataaggcggatcccctggccaag
cgcaccatcgccccgccggaaaccgcctccgtagtggcccgctccagtttcaagtggagc
gatgaggagtggatgagcaagcgcaccggggacctcgatgtcccgatgagtgtctacgaa
ctccacgtcggctcctggaaggtaggtgctaactacaacaccttgcgtgaagagctcatc
ccttacctaattgagcacggctttacccacgtggagctgctgcccgtggctgagcacccc
ttcggcggttcctggggctaccaggtctccggctactacgctccctccgcgcgctggggc
tccccggatgagctgcgcgcgcttatcgacgaattgcataacgccggcatcggcgtcttc
gttgactgggttcccgcgcacttccccaaggacgaatgggcgctgggccgcttcgatggg
caggcactctacgagcaccccgacccgcgccgcggtgagcaggccgattggggcacctac
gtcttcgacttcggccgcaacgaggtgcgcaacttcctcgtggctaacgccctgtactgg
gccgaggagttccacgtggatggcctgcgagtcgacgccgttgcatccatgctctacctg
gattactcccgcgaagaatggctgcccaatatctacggcgggcgcgaaaaccttgaggca
gtccaattcctccaggagaccaacgccacgctgaaccgtaaccacccgggcgtgctgacc
atcgccgaggaatccacctcctggccgggggtgaccgccccgacacatgagggtggattg
ggctttagcctgaagtggaacatgggctggatgaacgacaccctggagtacttcaagcac
gagccgattcaccgccgctaccaccatggcgagctcaccttctccatggtctacgcctac
tcggagcgctacgttctcccctttagccacgacgaagtggttcacggcaagggctccttg
tgggagcgcatgccgggcgatgactggaacaaggccgcgggcctgcgcgcgctgtacggc
tacatgttctcccacccgggcaagcaactgatgttcatgggccaggagtttggccagacc
accgagtgggcagagggccactccgtggactggtccaacttggagggctggggcaacgag
tggcaccacggcatcaagcgcctggtgcgcgacctcaacgcggtgtacaagcaacagcca
gccctgtggacccaggactttacacaagatggcttccagtgggtcaaggctgatgactcg
aataacaacatgctcggctacgtccgctacggcaaggacggctctgccctgttggcggtg
tgcaacttctccggcagctccgtgccgaactatgacctctgggtgccgcgcgacggtgaa
tgggagctgctcatcaacacagacgacgccgtctaccaaggcgccggcaacgacctagcc
caccgcgtgcgctccgaaggcaaccacgtacagctacacctgccggccaactcggtgcag
tggtacgccttccgtggctag

DBGET integrated database retrieval system