KEGG   Corynebacterium aurimucosum: cauri_1116Help
Entry
cauri_1116        CDS       T00887                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
car  Corynebacterium aurimucosum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:car01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:car01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:car00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:car00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:car00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:car00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:car00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1235597..1236628
Genome map
AA seq 343 aa AA seqDB search
MRLAVLTSGGDCPGLNAVIRAVVRTASNEFGDTVVGYEDGWVGLMEDRRRDLYDDAEIDR
ILLRGGTILGTGRLHPDKFKAGLDTIKANMADAEVDALIAIGGEGTLKGAKWLSDNGIPV
VGVPKTIDNDVNATDYTFGFDTAVSVATDAIDRLHTTAESHDRILIVEVMGRHVGWIALH
AGMAGGAHYTVIPEVPFDIADITKAMERRFQMGEKYGIVCVAEGALPKEGTMDFEEGGVD
QFGHQTFNGIGQVIGDEIKKRTGYDVRTTVLGHIQRGGTPTAYDRVLATRYGTHAARAAH
NGQSGMCVALHGENIDLVPLEDAVGKLKVVPAKRYANAQALFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcttgctgtactgacatccggtggtgattgccccggtctgaatgctgttatccgc
gcggtcgttcgtaccgcttccaacgagttcggcgatacggtcgtcggctacgaggacggc
tgggttggtctgatggaagaccgccgccgtgacctttatgacgacgctgagattgaccgc
atcctcctgcgcggcggaaccatcctcggtaccggccgcctccacccagataagttcaag
gctgggctggataccatcaaagccaacatggctgatgccgaggtcgatgctctcatcgcc
attggcggtgagggaacgctgaagggcgccaagtggctgtccgataatggcattccagtc
gtcggcgtgccgaagaccattgacaatgacgtcaatgcaacggactacacctttggcttc
gacaccgcagtctccgtcgccaccgacgcgattgatcgtctccacaccaccgccgaatcc
cacgaccgcatcctcatcgttgaggtcatgggccgccacgttggttggatcgcgctgcac
gccggcatggctggcggtgcacactacacggtgatccctgaggttccattcgatatcgca
gatatcaccaaggcaatggagcgccgcttccagatgggtgagaagtacggcattgtctgc
gttgccgaaggcgctctgcccaaggaaggcaccatggacttcgaagaaggcggtgttgac
cagttcggccaccagaccttcaacggaattggccaggtcatcggtgatgagatcaagaag
cgcaccggctacgacgtgcgcacaaccgtcctcggccacatccagcgtggtggtacccca
actgcctatgaccgcgtgctggcaacccgctatggcacccatgccgcccgcgccgcgcac
aatggacagtccggaatgtgcgtggccttgcacggcgaaaacatcgatctcgtgccgctc
gaggatgccgtgggcaagctgaaggtggttccggccaagcgttatgccaacgctcaagcc
ctctttggttaa

DBGET integrated database retrieval system