KEGG   Corynebacterium aurimucosum: cauri_1202Help
Entry
cauri_1202        CDS       T00887                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
car  Corynebacterium aurimucosum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:car00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cauri_1202 (tpiA)
   01230 Biosynthesis of amino acids
    cauri_1202 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    cauri_1202 (tpiA)
   00051 Fructose and mannose metabolism
    cauri_1202 (tpiA)
   00562 Inositol phosphate metabolism
    cauri_1202 (tpiA)
Enzymes [BR:car01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     cauri_1202 (tpiA)
Exosome [BR:car04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   cauri_1202 (tpiA)
  Exosomal proteins of bladder cancer cells
   cauri_1202 (tpiA)
  Exosomal proteins of melanoma cells
   cauri_1202 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1332741..1333520
Genome map
AA seq 259 aa AA seqDB search
MARTPLIAGNWKMNLDHKEAIGSLQKFAFSLPKEYYEKVDVAFMVPFTDIRTVQTLVDGD
DLQFTYGAQDISKHESGAYTGEVSGKMLSALGCSWAVVGHSERRQYHGETDQLVAEKAAA
ALANGISPIVCVGEPLNVREAGTHVDYVVTQTRNSLQGLSAEALSKTVIAYEPVWAIGTG
KVASAEDAQEVCAAIRELVRELGGDEVAEGIRILYGGSVKVDSIAEIVGKPDVDGGLVGG
ASLKGEEFAKLAANAAQGA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtaccccgcttatcgcaggtaactggaagatgaacctcgaccacaaggaagct
attggctccctgcagaagttcgctttctctttgccgaaggaatactacgagaaggttgac
gtggctttcatggtcccgttcaccgatatccgcaccgtgcagacgctggtcgacggcgac
gacttgcagttcacctatggtgcacaggacatttccaagcatgagtccggtgcatacacc
ggtgaggtgtccggcaagatgctctccgccctgggctgctcttgggcagtcgtcggacac
tcagagcgccgtcagtatcacggtgagaccgaccagctggttgcagagaaggccgctgca
gccctggctaacggtatcagtccgattgtctgcgtgggcgagccgcttaacgtgcgcgag
gcaggcactcacgtggattacgtggtcacccagacccgcaactccctgcaaggactttct
gccgaggccctctccaagaccgtcatcgcttatgagccggtctgggcaatcggtaccggt
aaggttgcttccgctgaggacgcgcaggaagtgtgcgcagctattcgcgagctcgtccgc
gagctgggcggcgatgaggtggcggagggtatccgcattctctacggtggctccgtcaag
gtggattccatcgcggagatcgtaggcaagccggacgttgacggtggccttgttggcggt
gcttctctcaagggtgaggagtttgccaagctggcggctaatgctgcccagggcgcatag

DBGET integrated database retrieval system