KEGG   Corynebacterium aurimucosum: cauri_1418Help
Entry
cauri_1418        CDS       T00887                                 

Gene name
ruvA
Definition
holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
car  Corynebacterium aurimucosum
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:car03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1577844..1578452)
Genome map
AA seq 202 aa AA seqDB search
MIASLRGTVLDIQLDHAVLECAGVGYKVLATPAMLGTLQRGEEARVMTTLVVKEDSMTLY
GFTSQDDRDMFHVLQTVSGLGPKLALAALSVMSAGDLAQAIAGEEAARLQKIPGVGKRVA
QRLILELKDKVKAFAPAESADLSSAAPAAAGPVVEDVVEALIGLGFTDKMARPVVESVVA
EQPDAATPVVLRAALSQLGAKK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgattgcatctttgcgcggaaccgtcctcgacatccagcttgatcatgccgtgctggaa
tgcgcgggcgtgggctataaggtcctggccaccccggccatgctgggaaccctccagcgc
ggtgaggaggcgcgggtcatgaccacgctcgtggtcaaggaggactcgatgacgctctac
ggcttcaccagtcaggatgaccgcgatatgttccacgtcctccaaacggtttctggtctg
gggccaaaactggcgctggctgccctgtccgtgatgagcgcgggcgatttggcccaggcg
attgcgggggaggaggccgcacgcttgcagaaaattccgggagtgggcaaacgcgttgcg
caacggttgattctggagcttaaagataaggtcaaggccttcgcccccgcagaaagcgcg
gatctctcgtctgctgccccggctgccgctgggccggtggttgaggatgtcgtcgaggcg
cttattggtttgggctttactgataaaatggcccggcccgtggtggaatccgtggtggca
gagcaacccgatgcggcgacgccggtggtgctgcgcgctgcgctgagccagcttggcgcc
aagaaatag

DBGET integrated database retrieval system