KEGG   Corynebacterium aurimucosum: cauri_1709Help
Entry
cauri_1709        CDS       T00887                                 

Gene name
pncA
Definition
pyrazinamidase / nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
car  Corynebacterium aurimucosum
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:car00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    cauri_1709 (pncA)
Enzymes [BR:car01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     cauri_1709 (pncA)
    3.5.1.-  
     cauri_1709 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1889737..1890279
Genome map
AA seq 180 aa AA seqDB search
MTPALIIVDVQYDFCPGGALGTERGNEVAERIGALQASYETVVATQDWHIDPGSHFAENP
DFVDTWPTHCVADSFGAAMHEAIAPAQAYFKKGEYTAAYSGFEGAANGVSLADWLREHNV
TAVDIVGIATDHCVRATAADALKEGFTVRVLADYCAPVDEARGAAALEDLAKAGATIVSE
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgacacctgcactcatcattgtcgatgtccaatatgatttttgtcccggcggagccctc
ggcaccgaacgcggcaacgaagttgctgagcgcatcggcgcactccaagcctcctatgag
acggtcgtagccacacaggattggcatatcgatccaggctcccacttcgctgagaacccc
gactttgtcgatacctggcctacacactgcgtggctgattctttcggcgccgccatgcac
gaggccatcgcgcccgcccaggcttacttcaagaagggcgaatacaccgccgcctactcg
ggcttcgaaggcgcggccaatggagtttccctggcggactggttgcgggagcacaacgtc
accgccgtggacatcgttggcattgccaccgatcactgcgtgcgcgcaacggctgccgac
gcccttaaggaaggcttcaccgtgcgggttctggcggactactgtgcgcccgtcgacgaa
gcccgcggcgccgccgccctggaggatttagccaaggcaggcgccaccatcgttagcgaa
taa

DBGET integrated database retrieval system