KEGG   Corynebacterium aurimucosum: cauri_1711Help
Entry
cauri_1711        CDS       T00887                                 

Gene name
sucB
Definition
(RefSeq) dihydrolipoamide succinyltransferase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
car  Corynebacterium aurimucosum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:car00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    cauri_1711 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    cauri_1711 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    cauri_1711 (sucB)
Enzymes [BR:car01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     cauri_1711 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1890856..1892556
Genome map
AA seq 566 aa AA seqDB search
MAHSVVMPELGESVTEGTITQWLKSVGDTVEVDEPLLEVSTDKVDTEIPSPVAGTILEIK
AEEDDTVDVGAVIAIIGDEGESAPAAEESEDSSEKAAETPDKPAEDAESEAPAASGDATD
VEMPELGESVTEGTITQWLKSVGDTVEVDEPLLEVSTDKVDTEIPSPVAGTLVEILAEED
DTVDVGAVIARVGDGSAAASEKPAAKEEKAEEKKEEPKAEEKKEEPKAEEKKPAASQSSE
PKTSETSTKVNNGDNVPYVTPLVRKLAEKHGVDLSTVSGTGVGGRIRKQDVLAAAGEGEA
PASSASASSSNPRARWSTKSVDPEKQELIGTTQKVNRIREITASKMVEALQISAQLTHVQ
EVDMTAIWDMRKQSKQAFIDKYEANLSFLPFIVKATVEALVSHPNVNASYNPETKEMTYH
ADVNVAIAVDTPRGLLTPVIHKAQELTLPEIAQKIAELADKARNNKLKPNDLTGATFTVT
NIGSEGALLDTPILVPPQAGILGTAAITKRAVVVTEDGQDAIAIRQMCYLPFTYDHQVVD
GADAGRFITTIKDRLETADFEADLDL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggcacactctgttgtgatgcccgaactgggcgaatctgtaaccgaaggcacgattacc
cagtggctgaagtccgtcggcgacaccgtcgaggtcgacgagccattgctcgaggtctcc
accgacaaggtcgacaccgaaatcccctccccggtcgccggcaccatcctcgaaatcaag
gctgaggaagatgacaccgtagacgtgggcgcagtcatcgccatcatcggtgatgagggc
gagtctgcaccggctgctgaggagtccgaggattcctccgagaaagctgctgagaccccg
gacaagcctgctgaggacgctgagtctgaggctccggctgcttctggtgacgccaccgac
gtagagatgccggagctcggtgagtccgtcaccgaaggcaccatcacccagtggctgaag
tccgtcggcgacaccgtcgaggtcgacgaaccactcctcgaggtctccaccgacaaggtc
gacaccgaaatcccctccccggtcgccggcaccctcgttgaaatcctcgccgaggaagac
gacaccgtcgacgtcggcgccgtcatcgcccgcgtaggcgacggctccgccgcagcctcc
gagaagcccgccgccaaggaagaaaaggcagaggaaaagaaggaagagcccaaggctgag
gagaagaaggaagagcctaaggcagaagagaagaagcctgctgcttcccagtcctccgag
ccgaagacttctgagacttccaccaaggtcaacaacggcgataacgtcccgtacgtcacc
ccgctggtgcgcaagctggctgagaagcacggcgttgacctctccaccgtctctggcact
ggcgtcggcggccgcatccgcaagcaggacgtcctggccgcggctggcgagggcgaggca
ccggcttcctctgctagcgcatcctccagcaacccgcgtgctcgctggtccaccaagtcc
gtggatccggagaagcaggagctcatcggcaccacccagaaggtcaaccgtatccgcgag
atcacggcgtccaagatggttgaggccctccagatttccgctcagctgacccacgtccag
gaagtcgatatgaccgccatctgggatatgcgcaagcagtccaagcaggcgttcattgat
aagtacgaggccaacctctccttcctgccgttcattgtgaaggccaccgttgaggcactg
gtctcccacccgaacgtcaacgcgtcctacaacccggagaccaaggagatgacctaccac
gctgacgtcaacgtggccatcgccgtggatactccgcgtggcctgctgaccccggtcatc
cacaaggcccaggaactgacgctgccggagattgcccagaagatcgccgagctggcagac
aaggcacgcaacaacaagctcaagccgaatgatctgaccggtgcaaccttcaccgtgacc
aacatcggctccgagggcgccctgctggataccccgattctggttccgccgcaggccggc
atcctgggcaccgccgctatcaccaagcgcgcggtcgtcgtgaccgaggacggccaggac
gcgattgccatccgccagatgtgctacctgccgttcacctacgaccatcaggtggtcgac
ggtgccgacgctggtcgcttcatcacgaccatcaaggaccgcctcgaaaccgcagatttc
gaagccgaccttgacctctaa

DBGET integrated database retrieval system