KEGG   Corynebacterium aurimucosum: cauri_1732Help
Entry
cauri_1732        CDS       T00887                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
car  Corynebacterium aurimucosum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:car00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    cauri_1732
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cauri_1732
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    cauri_1732
Enzymes [BR:car01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     cauri_1732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1914265..1915710)
Genome map
AA seq 481 aa AA seqDB search
MKYISTRDTDRHPASFTDILLGGLAPDGGLYLPETYPRIDDATLTHWRQTLAEGGYAALA
ADVLKLFVDDIPAEDLEGIAQRAYTYPKFDHEEIVPVSELGEGLYIGHLSEGPTAAFKDM
AMQMLGELFEYELARRGETLNILGATSGDTGSSAEYAMRGRKGIRVFMLTPAGRMTPFQQ
AQMFGLDDPNICNIALDGVFDDCQDVVKAVSADANFKAENRIGAVNSINWARLMAQVVYY
INCYLKITTENTERVSFSVPTGNFGDICAGHIARQMGLPIDKLIVATNENDVLDEFFRTG
SYRPRSSEQTYKTSSPSMDISRASNFERFAFDLLGRDAAQIKELFGTKVKEGGFNVDKQA
LDAAHAEYGFLSGSSTHADRLATIKDVHERYDVLVDPHTADGIKVARAVQEEYGVDTPII
CLETALPVKFAETIKEAIGSEPEVPERFAEILEAERHVTDLPNDAAAVKDYITQYIKSTE
V
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtacatttcgacccgcgataccgaccgccatcccgcctcctttacggatatcctt
ctgggaggcttggcccccgatggcggcctctacctgccggaaacttacccccgcatcgat
gacgccaccctgactcactggcgccagaccttggcggagggcggctacgcggccttggcc
gcggacgtgctcaagctcttcgtggatgatattcccgcagaagacctcgaaggaattgcc
cagcgcgcctatacctaccccaagtttgatcacgaggagattgtccccgtcagcgagctg
ggggaggggctctacattggccacctctctgaggggccgacggccgccttcaaggacatg
gccatgcagatgttgggcgagctcttcgaatacgagctggcccgccgcggcgaaaccctc
aatattctgggcgctacctctggcgataccggttcctcggcggagtacgccatgcgcggg
cgcaagggcatccgtgtcttcatgctgaccccggccgggcgcatgacgcccttccagcag
gcccagatgttcggcctggatgatccgaatatctgcaatatcgccctcgacggcgtcttt
gatgattgccaggacgtggtcaaggctgtttcggccgacgctaatttcaaggcagagaac
cgcatcggcgcggtcaactccattaactgggctcgcctcatggcgcaggtggtctactac
atcaattgctacctcaagatcaccacggaaaacacggagagggtctccttcagcgtcccg
actggcaactttggggatatctgcgccggccacatcgcccgccagatgggcctgcccatc
gacaaactcatcgtcgcgaccaatgaaaacgacgtgctcgatgagttcttccgcaccggc
agctaccgcccgcgttcctcggagcagacgtacaaaacctcctcgccgtcgatggatatt
tcccgcgcctccaactttgagcgcttcgcttttgatctgctgggccgcgatgccgcacag
attaaggagcttttcgggacaaaggtgaaggaaggcgggtttaacgtcgacaagcaggca
cttgacgccgcccacgcggagtacggtttcttgtccggttcctccacccacgcggaccgc
ctcgccaccattaaggatgtccacgagcgctacgacgtgctggtggatccgcacacggcc
gacggcatcaaggtcgcccgcgcggtacaggaagagtatggggtcgatacccccatcatc
tgtctggagaccgccctgccggtgaagtttgcggagaccatcaaggaagccattggcagc
gagccggaggtgccggagcgtttcgccgaaatccttgaagccgagcgtcacgtcaccgac
ctgccaaacgatgccgcggcggtgaaggattacatcacgcagtacatcaagagcacggag
gtttaa

DBGET integrated database retrieval system