KEGG   Corynebacterium aurimucosum: cauri_1817Help
Entry
cauri_1817        CDS       T00887                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
car  Corynebacterium aurimucosum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:car00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2018776..2020893
Genome map
AA seq 705 aa AA seqDB search
MAQLGDVTTRDLLQELAQRHGVACEYTAQNGQPVYVSEETITYTLRALGVSISERPDDDE
LTQALFEDYLERASRPLPPCVVAREGAEKSFAVHVHDGDPVTVTIELENGETRPTYQDPN
DAPAADVAGTMWGEASFHVPGDLPLGFHKLRLSSPGIGEHECPLIVVPNHLSTADRYLDR
PAAGAMAQLYSVRSEKSWGMGDFGDLAELAETLAPDYDFLLINPLHAGEPIPPVEDSPYL
PTTRRFINPIYIRIEDIPELKQLSPELQEDVAELAAEFRERNRSAEEIDRDSIFEAKLQV
LQELFSKGMTPERRTAFSEYQRREGRGLRNFALWCAETELSRHSGRRHALSLDVNDVAEF
YSWLQFLCDEQLDAAQRRALDAGMSIGLITDMAVGIHPAGADAVNLAEYLAPQCSVGAPP
DDYNQQGQDWSQPPWHPVRLAEAGYEPWRDLLRTMLGNAGGLRVDHVLGLFRLYWIPRQS
TPLNGTYVTYDWEAMLGILALEAERAGAVLVGEDLGTLEPWVQNALRDMGVLGTTIIWFE
HAEDGPTPRPQDQYRHMAMSSVGTHDLPPTLAFLRGDHIELRARLGLLTRPVAEEEAEDR
AWQEKVKDNLQAYGMLENRESEEDVLVALHRYVAGTPSALTVTNVVDMVGDVRAQNQPGT
TKDQYPNWCIPLCDTAGKPVLLEDLPKQELYQRLAQAAKRPGAER
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
gtggcacaattgggtgatgtgactacccgtgatctgcttcaagaacttgcccaacgccac
ggcgtggcctgcgagtacaccgcccagaacggacagcccgtgtacgtcagcgaggagaca
attacctatacgctgcgcgcactcggcgtctctatctccgagcgtccggacgatgacgag
ctaacccaagccctgttcgaggactacctcgaacgcgcctcccgcccgctgccgccctgc
gtggtggcccgcgaaggcgccgaaaagtccttcgccgtccacgtccacgacggcgacccc
gtcaccgtcaccatcgagctagaaaacggcgagacgcggccgacctaccaggacccgaac
gacgccccggctgccgacgtcgccggcaccatgtggggcgaggccagcttccacgtcccc
ggggacctgcccttaggtttccacaagctgcgcttgtcctcccccggcatcggcgagcac
gagtgcccgctcatcgtggtgccgaatcatctgagtacggcggatcgctacctcgaccgc
ccggcggcgggcgcgatggcgcagctgtattcggtgcgctcggaaaagtcctggggaatg
ggcgattttggagacctcgccgagctggcggagaccttggcgcccgattatgacttcctc
cttattaacccgctgcacgcgggcgagccgatcccgccagtggaggattcgccctatctg
cccaccacgcggcgtttcatcaacccgatttatatccgtatcgaggatattccggagctg
aaacagctcagcccggagcttcaggaagacgtcgccgagctcgccgccgagttccgcgag
cgcaaccggtctgcagaagagattgatcgtgattccatcttcgaagccaagctgcaggtc
ctgcaggagctcttcagcaaggggatgaccccggagcgccgcaccgccttcagcgagtac
cagcgccgcgagggccgcggcctgcgcaacttcgcgctgtggtgtgcagagactgagctc
tcgcgccacagcggacgccgccacgcgttgagcctcgacgtcaacgacgtggccgagttc
tattcctggctgcaattcctctgcgatgagcagctggatgccgcccagcgccgcgcgctc
gatgccggcatgagcatcggcctcatcaccgatatggccgtaggcatccaccccgctggt
gccgatgccgtgaacctggcggaatacctcgccccgcaatgctcggtgggcgccccgccg
gatgactataaccagcaaggccaggactggtcccagccaccgtggcacccggtccgcctg
gcggaagccggctacgagccatggcgcgatttgctgcgcacgatgctgggcaatgctggt
ggcctgcgcgtcgaccatgtcctgggcctgttccgcctgtactggatcccgcgccaatcc
accccgctcaacggcacctacgtgacctatgactgggaagccatgctcggtatcctcgcg
ctcgaggctgagcgtgccggcgcggtcctcgtgggcgaggacctgggcaccctggagccg
tgggtccaaaacgctttgcgcgatatgggcgtgctaggcaccacgatcatctggtttgag
cacgcggaggacggccccaccccgcgcccgcaggatcagtaccgccacatggcgatgtcc
tcggtgggcacgcacgatctgccgccgacgctcgccttcctacgcggcgaccacatcgag
ctgcgcgcccgcttgggcctgctcacccgccccgtcgcggaagaagaggcagaggaccgc
gcctggcaagaaaaggtcaaggataacctgcaggcctatggcatgttggaaaaccgcgag
agcgaggaggacgtgctcgtcgccctgcaccgttatgttgcgggaactccctcggcgctg
acggtcaccaacgtggtggacatggttggtgacgtgcgcgcgcagaaccagccgggcacg
acgaaagaccagtaccccaactggtgcatcccgctgtgcgataccgccggtaagccggtg
ctcctggaggatctaccgaagcaggagctctaccagcgcctcgcccaggctgccaagagg
ccaggggccgaacgctaa

DBGET integrated database retrieval system