KEGG   Corynebacterium aurimucosum: cauri_2243Help
Entry
cauri_2243        CDS       T00887                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
car  Corynebacterium aurimucosum
Pathway
car00790  Folate biosynthesis
car01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:car00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    cauri_2243 (folE)
Enzymes [BR:car01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     cauri_2243 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI DUF2785 SnoaL_3
Motif
Other DBs
NCBI-ProteinID: ACP33834
UniProt: C3PJE8
Position
complement(2440723..2441313)
Genome map
AA seq 196 aa AA seqDB search
MSDNIPAQREFDHERAEAAVRELLIAVGEDPDREGLRETPARVARAYAEVFAGLHQDPTE
VLHKTFAEEHQELVLVRDIPIYSTCEHHLVPFYGTAHIGYIPGTDGHVTGLSKLARLADM
YAKRPQVQERLTSQIADALVEVLHAQSVIVVIECEHLCMAMRGIRKPGATTTTSAVRGGF
KKNAASRAEVMSLIRS
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgagcgataacatcccggcgcagcgcgagttcgatcacgagcgcgccgaagccgccgtc
cgtgagctgctcatcgcggtgggcgaggaccccgaccgcgagggcctgcgcgagaccccg
gcccgcgtggcccgcgcctatgccgaggtcttcgcaggactccaccaggatccgactgag
gtcctgcacaagacctttgccgaggagcaccaagagctcgtcctcgtgcgcgatatcccc
atctactccacctgcgagcaccacctcgtgcccttctacggcacagcgcatatcggctat
atccctggcaccgacggacacgtcaccggactgtccaagctggctcgcctggcggacatg
tacgccaagcgcccgcaggtgcaggagcggttgaccagccagatcgccgatgcactggtg
gaggttctccacgcgcagtccgtcatcgtcgtcatcgagtgcgagcacctgtgcatggcc
atgcgcggcatccgcaagccgggggcgaccacgacgacctccgcggtgcgcggcggattc
aagaagaatgccgcctcccgcgcggaggtcatgagcttgattaggagctag

DBGET integrated database retrieval system