KEGG   Corynebacterium aurimucosum: cauri_2350Help
Entry
cauri_2350        CDS       T00887                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
car  Corynebacterium aurimucosum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:car00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    cauri_2350
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    cauri_2350
Enzymes [BR:car01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     cauri_2350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2572622..2573671)
Genome map
AA seq 349 aa AA seqDB search
MKKAMPALLLSAICALSACSTEPELSDAPPSETSAAASSDAAPQDAAPEDVRARAAAKLM
PPALNYEDARAKLEAGVGGLFIPSWADPELLSDGPRGVNALREEMGRDFEVSIDFEGGRV
QRFSEILGDYPSPQAMAEGHSPEEVEALATEIGHSLRAHGVTVDFAPVLDVDGGDLEVVG
DRAFSTDPAAAGEYGAAFARGLQAAGVKAVFKHFPGHGRASGDTHLGEAVTPPLEELSGH
EFVPFHTAIPQAPEAAIMMGHLVVPGLGEEPASLNPRAYQLAREELDFEGTIYTDDLGGM
ASISENFSVPEAVAAALAAGADMPLWSTDEDINAVIDAAAEVVAQQERD
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcaatgcccgccctcctgttgagtgctatctgtgcgctaagcgcgtgcagt
acggagcctgagctttccgacgccccgcctagcgaaaccagcgccgcggcgtctagcgat
gcggcaccacaggatgccgcgcctgaagacgttcgtgcccgcgccgccgccaagctcatg
ccgccggcgctgaactacgaggatgcccgcgctaagctcgaggccggcgtgggcgggctc
ttcatccccagctgggccgacccggagctgctgagcgatggcccgcggggagtgaacgct
ttgcgtgaggagatgggccgcgactttgaggtctccatcgacttcgagggcgggcgtgtg
cagcgcttctccgaaatattgggagactacccctccccgcaggccatggcggagggccat
agcccggaagaggtcgaggccctggccacggagatcgggcacagcctgcgcgcccacggc
gtgacggtggacttcgcccccgtgctcgacgtggatgggggagacttggaggtcgtcggc
gaccgcgccttctccaccgacccggcggccgccggtgagtatggcgcggcctttgcccgc
gggctgcaggctgccggtgtgaaggccgtgttcaaacacttcccgggccacggccgcgcc
tccggggatacgcacctgggtgaggccgtgaccccgccgttagaagagctctctggtcac
gagttcgtgcctttccacacggcaatcccgcaagccccggaagcagcgatcatgatgggc
cacctcgtggttccaggcctcggcgaggagcccgcctccctcaacccgcgggcctaccag
ctcgcccgcgaggagctggactttgagggcaccatttacaccgatgacctgggcggaatg
gcgtccatctcggagaacttcagcgtgccggaggccgtggccgcagcccttgccgcaggt
gccgatatgccgctgtggtccaccgacgaggacattaacgcggtcattgatgcagctgcc
gaagtcgtggcccaacaggagcgcgactag

DBGET integrated database retrieval system