KEGG   Corynebacterium aurimucosum: cauri_2511Help
Entry
cauri_2511        CDS       T00887                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
car  Corynebacterium aurimucosum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:car00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    cauri_2511 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cauri_2511 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    cauri_2511 (trpB)
Enzymes [BR:car01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     cauri_2511 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2757872..2759086
Genome map
AA seq 404 aa AA seqDB search
MTNDQDIRETILPAYFGEFGGQFVPESLIPALDQLEQAFVDAQNDPAFREELASYLRDYL
GRPTPLTEATKLGGKARIFLKREDLVHGGAHKTNQVIGQALLAKRMGKTRIIAETGAGQH
GTATALACALLDLDCVIYMGAKDVERQQPNVYRMELMGAKVVPVDSGSGTLKDAVNEALR
DWTATFHESHYLLGTAAGPHPFPTIVREFHKVISEEAKAQMLERTGGLPDVVVACVGGGS
NAIGMFADFIDEESVELVGAEPGGEGLDSGHHGATINNGTIGILHGARSYLMRNADGQVE
ESYSISAGLDYPGVGPQHAHLAQTGRATYIGITDAEALEAFQILSRREGIIPALESSHAL
AYALKRKDEDITILVSLSGLGDKDIDHVRRTLDTHPEFKITEDK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgatcaggacatcagggagaccattcttcccgcctacttcggtgaatttggc
ggacaatttgttcccgaatcactcattccagcactcgaccagctcgagcaagccttcgtc
gacgcccagaatgatccggccttccgcgaggagcttgccagctacctgcgggactacctg
ggccgccccacgcctctcaccgaagcgaccaaacttggcggaaaggcgcgcatcttcctc
aagcgtgaggacctcgtgcacggaggcgctcacaagaccaaccaggtaatcggccaagcg
ctcttggctaagcgaatgggcaagacccgcattatcgcggagaccggcgccggccagcat
ggcacggcgaccgccctcgcctgtgctctgcttgacctcgattgcgtaatctacatgggc
gcaaaggacgtcgaaaggcagcagcccaatgtctaccgcatggaactcatgggcgcgaaa
gttgttcccgtggattctggttccggcaccctcaaggatgctgtcaacgaagctctccgt
gactggaccgcgacgttccacgagtctcactacctcctaggcaccgcggccggccctcac
cccttcccgacgattgttcgagaattccacaaagtcatttctgaggaagccaaggctcaa
atgctggagcgcactggcgggctccccgacgtggtcgtcgcctgcgtcggcggcggctcc
aatgccattggcatgtttgcggatttcatcgacgaggaatcagtcgaactcgtcggtgcc
gagcctgggggagagggcctagactccggccaccatggcgccacgatcaacaacggcacc
attggcatcctccacggtgcccgctcctatctcatgcgcaatgctgacgggcaagttgag
gaatcctattctatttctgccggcctcgattacccgggtgtaggcccacaacacgcccac
ctcgcacagaccggccgagccacttatatcggcatcaccgacgccgaagcactcgaagcc
ttccagattctcagccgacgggagggcatcatcccagctctcgaatcctcgcatgccctt
gcctatgcactcaagcgcaaagatgaggacatcaccattctcgtttccctttctggcctc
ggtgacaaggacatcgaccacgttcgccgcaccctcgacacgcatcccgaattcaagatc
acggaggacaagtaa

DBGET integrated database retrieval system