KEGG   Corynebacterium aurimucosum: cauri_2511Help
Entry
cauri_2511        CDS       T00887                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
car  Corynebacterium aurimucosum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:car00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    cauri_2511 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cauri_2511 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    cauri_2511 (trpB)
Enzymes [BR:car01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     cauri_2511 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2757872..2759086
Genome map
AA seq 404 aa AA seqDB search
MTNDQDIRETILPAYFGEFGGQFVPESLIPALDQLEQAFVDAQNDPAFREELASYLRDYL
GRPTPLTEATKLGGKARIFLKREDLVHGGAHKTNQVIGQALLAKRMGKTRIIAETGAGQH
GTATALACALLDLDCVIYMGAKDVERQQPNVYRMELMGAKVVPVDSGSGTLKDAVNEALR
DWTATFHESHYLLGTAAGPHPFPTIVREFHKVISEEAKAQMLERTGGLPDVVVACVGGGS
NAIGMFADFIDEESVELVGAEPGGEGLDSGHHGATINNGTIGILHGARSYLMRNADGQVE
ESYSISAGLDYPGVGPQHAHLAQTGRATYIGITDAEALEAFQILSRREGIIPALESSHAL
AYALKRKDEDITILVSLSGLGDKDIDHVRRTLDTHPEFKITEDK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgatcaggacatcagggagaccattcttcccgcctacttcggtgaatttggc
ggacaatttgttcccgaatcactcattccagcactcgaccagctcgagcaagccttcgtc
gacgcccagaatgatccggccttccgcgaggagcttgccagctacctgcgggactacctg
ggccgccccacgcctctcaccgaagcgaccaaacttggcggaaaggcgcgcatcttcctc
aagcgtgaggacctcgtgcacggaggcgctcacaagaccaaccaggtaatcggccaagcg
ctcttggctaagcgaatgggcaagacccgcattatcgcggagaccggcgccggccagcat
ggcacggcgaccgccctcgcctgtgctctgcttgacctcgattgcgtaatctacatgggc
gcaaaggacgtcgaaaggcagcagcccaatgtctaccgcatggaactcatgggcgcgaaa
gttgttcccgtggattctggttccggcaccctcaaggatgctgtcaacgaagctctccgt
gactggaccgcgacgttccacgagtctcactacctcctaggcaccgcggccggccctcac
cccttcccgacgattgttcgagaattccacaaagtcatttctgaggaagccaaggctcaa
atgctggagcgcactggcgggctccccgacgtggtcgtcgcctgcgtcggcggcggctcc
aatgccattggcatgtttgcggatttcatcgacgaggaatcagtcgaactcgtcggtgcc
gagcctgggggagagggcctagactccggccaccatggcgccacgatcaacaacggcacc
attggcatcctccacggtgcccgctcctatctcatgcgcaatgctgacgggcaagttgag
gaatcctattctatttctgccggcctcgattacccgggtgtaggcccacaacacgcccac
ctcgcacagaccggccgagccacttatatcggcatcaccgacgccgaagcactcgaagcc
ttccagattctcagccgacgggagggcatcatcccagctctcgaatcctcgcatgccctt
gcctatgcactcaagcgcaaagatgaggacatcaccattctcgtttccctttctggcctc
ggtgacaaggacatcgaccacgttcgccgcaccctcgacacgcatcccgaattcaagatc
acggaggacaagtaa

DBGET integrated database retrieval system