KEGG   Corynebacterium aurimucosum: cauri_2512Help
Entry
cauri_2512        CDS       T00887                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
car  Corynebacterium aurimucosum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:car00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    cauri_2512 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    cauri_2512 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    cauri_2512 (trpA)
Enzymes [BR:car01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     cauri_2512 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2759086..2759916
Genome map
AA seq 276 aa AA seqDB search
MSRYEKLFSSLAARKEGAFVPFIMLSDPNPDTALAIVRAAVAGGADALELGVPFSDPVAD
GPTIQASHIRALAGGATVDSAIEQIRRIRNEFPDLPIGMLIYGNVPFTRGLETFYSEFQE
AGADSILLPDVPVREGAPFVAAAEKAGIDPIFIAPAQASEQTLQGVAQYSKGYIYAISRD
GVTGTEKESETRGLDEVVNNVKRFGGAPILLGFGISTPQHVADAIAAGAAGAITGSALTK
IVDAHLDEEGRPADGLAAAVTGFVSKMKAATKHAES
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagccgctacgagaaacttttctccagcctcgccgcccgcaaggaaggggcatttgtc
cccttcatcatgctgagcgatcccaacccagacaccgctctcgccattgttcgcgccgct
gtcgccggtggtgccgacgcgctcgagctcggcgtccccttctccgatccggtcgccgac
ggccccaccattcaggcctcccatatccgcgcacttgcaggcggcgcgacggtcgactcc
gcgatcgaacaaatccgccgcatccgaaacgaattccccgacctaccaatcggcatgctc
atctacggaaacgttcccttcactcgcgggttagagaccttctactccgagttccaggaa
gcgggtgccgatagcatcttgcttcccgacgtccccgttcgcgaaggcgcacctttcgtc
gccgctgccgaaaaagccggaattgacccaatctttatcgccccggctcaagcatctgaa
caaactctccagggagtggctcagtactccaagggctatatctacgctatctcgcgcgac
ggcgtcactggcaccgagaaggagtcggaaactcgcgggctcgatgaagtggtgaataac
gtgaagcgcttcggtggagcgccgattcttcttgggttcggtatctcgacgcctcagcac
gtcgccgacgcaatcgccgccggcgcagctggtgcaatcaccggttccgctttaacgaag
attgtcgacgcccacctcgacgaagaaggccgccccgccgacgggctcgccgctgcggtc
accggctttgtctccaagatgaaggccgctaccaaacatgcagaatcctaa

DBGET integrated database retrieval system