KEGG   Croceibacter atlanticus: CA2559_00520Help
Entry
CA2559_00520      CDS       T01256                                 

Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cat  Croceibacter atlanticus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cat00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CA2559_00520
Enzymes [BR:cat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     CA2559_00520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(130458..131408)
Genome map
AA seq 316 aa AA seqDB search
MSTTKNYAGIPDEFANAETSKIVLIPVPYDGTSTWGKGADKGPEAFLHASEQMELYDIET
ETEVYKQGVYLADPVTESETPKKMAKAVHDITKGHIKRNKFVTLFGGEHSISIGAIRAFN
ECFEDLTVLQIDAHTDLRKKYEGSKYNHACAVYEANETTNLIQVGIRSMDIAETTVMNKD
NVFFAHDMATDDYWMDNAVELMTDNVYITFDLDAFDPSIMPSTGTPEPGGLLWYETLEFL
KKVFTEKNVVGFDIVELCPNKNDKSSDFLAAKLYYKMLTYKFENEAIDAAFDHESEYNAS
QKKQLSNKTQHDDYEQ
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaactaaaaattatgcaggcattccagatgaatttgcgaatgcagaaacttct
aaaatcgttcttattcctgttccttatgatggtacaagtacttggggaaaaggagcagat
aaaggtcctgaggcatttttacacgcttcagaacaaatggaattgtatgatatagaaaca
gagacagaggtttataaacaaggcgtatatcttgcagatcctgttacagaaagtgagacg
ccaaaaaaaatggctaaagccgttcatgatattacaaaaggacatataaaacgcaacaag
tttgtaaccttatttggtggagaacattcaatatctataggagctataagagcttttaat
gagtgttttgaagatttaacagtcttacaaatagatgcccatacagatcttagaaagaaa
tatgaaggcagcaaatacaaccatgcatgtgctgtttatgaagctaatgaaactactaac
cttatacaagtaggcatacgtagtatggacatagccgaaacaacagtaatgaataaagac
aatgtcttttttgctcacgatatggcaacagatgattattggatggataatgctgtagag
ttaatgacagataatgtttacatcacttttgatttagatgcattcgacccatcaatcatg
ccatctactggaacaccagaaccaggaggattactttggtatgagactttagaatttcta
aaaaaggtatttaccgaaaaaaatgtggtagggtttgatattgttgagctttgcccaaat
aaaaatgacaagtcttcagactttttagcagctaaactctattacaagatgcttacatac
aagtttgaaaacgaagctatcgatgcagcttttgatcacgaatctgaatacaatgcatca
caaaaaaaacaactttctaacaaaacacaacacgacgattatgagcaataa

DBGET integrated database retrieval system