KEGG   Croceibacter atlanticus: CA2559_00785Help
Entry
CA2559_00785      CDS       T01256                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cat  Croceibacter atlanticus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CA2559_00785
Enzymes [BR:cat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CA2559_00785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
194920..195597
Genome map
AA seq 225 aa AA seqDB search
MKLDDLLENVEERGDNHAGASRETPLRDNAFDLDDQEKITLIQDDVKRILETLGMDLTDD
SLKGTPLRVAKMFVKEIFGGLHPDRKPKASTFENKYQYGEMLVEKNITVYSTCEHHLLPI
VGKAHVAYISKGNVVGLSKMNRIVDYYAKRPQVQERLTLQIVEELQKVLGTEDVACVIDA
KHLCVNSRGIRDIDSSTVTSEFGGQFKDKETKREFLDYIKLDTEF
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaagctagacgatttattagaaaatgtagaagaacgtggtgacaatcacgcaggagca
agtagagagaccccattaagagacaacgcttttgatcttgatgaccaagaaaaaatcact
ttaatacaagatgatgtaaagcgtattttagaaactcttggtatggatcttacagacgac
agtcttaagggcacacctttacgcgttgctaaaatgtttgttaaagaaatttttggcggt
ctacatccagacagaaagccaaaagcatctacttttgaaaacaagtaccaatacggtgaa
atgctagttgaaaaaaacattactgtttactctacctgcgaacaccatttacttcctatt
gtaggaaaagcacacgtagcttacatctcaaaaggaaatgtagtaggcctctctaaaatg
aacagaattgtagattactacgcaaagcgaccacaagtgcaagagcgattaactttacaa
attgttgaagaacttcaaaaagtattaggcacagaagacgttgcctgtgttatagatgcc
aaacacctttgcgtaaacagtagaggaattcgtgatatagatagcagtactgttactagc
gagtttggcggacaatttaaagacaaagagacaaaacgcgagtttttagattacataaaa
cttgataccgaattttaa

DBGET integrated database retrieval system