KEGG   Croceibacter atlanticus: CA2559_01215Help
Entry
CA2559_01215      CDS       T01256                                 

Definition
Holliday junction DNA helicase motor protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cat  Croceibacter atlanticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cat00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CA2559_01215
Enzymes [BR:cat01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CA2559_01215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(300124..300705)
Genome map
AA seq 193 aa AA seqDB search
MITQLAGQLIEKNPTNIIVDCGGVGYFVNISLHTFGLIKNEECVKIFTHLQVREDAHTLF
GFAEKAEREVFRLLIGVSGIGASTARTMLSSLTPQQVTEAISQGDVATIQSVKGIGLKTA
QRVIIDLKDKILNVVGLDEVLPSQGNTQKEEALSALETLGYTRKQSDKVVAGILKTDPEA
SVETIIKLALKKL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgataacccaactagctggtcaattaatagagaaaaaccctacaaacattattgtagat
tgtggtggcgtcggctattttgtaaatatttcattgcacacttttggccttattaaaaat
gaagaatgcgtaaagatttttactcacctacaagtaagagaagatgcgcatacattattt
ggctttgcagaaaaagcagagcgagaagtttttagattattaataggtgtttcgggtatt
ggtgcaagtactgcaagaacaatgttgtcatcactaactccgcaacaagttacagaagca
atatctcaaggagatgttgcaactatacaatctgttaaaggaatagggttaaagactgcg
caacgtgttattatagatcttaaggataagatacttaatgttgtaggcttagatgaagtt
ttgccatcccaaggcaatactcaaaaagaagaagcgttatctgctttagaaaccttagga
tatacgaggaaacaaagcgacaaagtcgtggcaggaatactcaaaacagatccagaagct
tccgttgaaactatcatcaaactagcacttaaaaaactttag

DBGET integrated database retrieval system