KEGG   Croceibacter atlanticus: CA2559_01650Help
Entry
CA2559_01650      CDS       T01256                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cat  Croceibacter atlanticus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cat00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
414013..414759
Genome map
AA seq 248 aa AA seqDB search
MKVKTILVSQPEPKIENSPYFELEEKQKVKIDFIPFIHVEGVSSKDVRQQKVDLKNYTAI
ILTSRNAVDHFFRIAEELRYTVPDSLKYFCQSEAVAYYLQKYVVYRKRKIYVGKRTFQEL
TPLIKKHKNEKFLLPSSDMLKPMVPETLDELGVSWKQAIFYKTVVSDLSNLRDVFYDILV
FFSPSGIKSLFENFPDYQQNNTRIAVFGNTTIKAAEDHGLKVNIKAPSPETPSMTMALKK
YITEVNKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgaaaacaattttggtttcccaacctgaacctaaaatagaaaattcaccttac
tttgagcttgaggaaaagcaaaaagtaaaaatagattttattccttttatacatgttgaa
ggcgtctcttctaaagatgtaagacaacaaaaggttgatctaaagaattacacagcaatt
atacttactagtagaaatgcagtagatcattttttcagaatagctgaagaattaagatac
actgtaccagattctcttaagtatttttgccaaagtgaagctgttgcctattacctacaa
aaatatgtagtgtatagaaaacgaaaaatctatgttggtaaaagaacatttcaagagtta
actcctcttattaagaaacataaaaacgagaagtttttattaccttcttcagatatgcta
aaaccaatggttccagaaacattagatgaactaggtgtttcttggaaacaagctattttc
tacaaaactgtagttagtgacctttctaatttaagagatgtattttatgacatcttagta
ttctttagcccaagcggcataaagtctttatttgaaaactttccagattatcagcaaaac
aatacacgcattgctgtttttggaaacactacaattaaagctgcagaagatcacggctta
aaggtaaacattaaagcaccttcaccagaaacaccatctatgacaatggctttaaagaaa
tacattacagaagttaataagaagtaa

DBGET integrated database retrieval system