KEGG   Croceibacter atlanticus: CA2559_02005Help
Entry
CA2559_02005      CDS       T01256                                 

Definition
2-oxoglutarate dehydrogenase complex, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cat  Croceibacter atlanticus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CA2559_02005
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CA2559_02005
  Amino acid metabolism
   00310 Lysine degradation
    CA2559_02005
Enzymes [BR:cat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CA2559_02005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
494707..495999
Genome map
AA seq 430 aa AA seqDB search
MALEMKVPSPGESITEVEIAQWLVEDGDYVEKDQAIAEVDSDKATLELPAEASGIITLKA
EEGDAVEVGAVVCLIDTDAKKPGGDDKAASGDEGSGDDAEKDLKEQNKKTEDTNEKGDAL
KQTPSKPSTQDQKQDNKNYATGSPSPAAKKILDEKGMDSKDVSGSGRDGRITKDDAVKAK
PSMGSPGNGKRGESRTKLSMLRRKVAERLVSAKNETAMLTTFNEVDMSPIFSLRKQYKEE
FKAKHGVSLGFMSFFTLACVRALEMYPAVNSMIEGKEMITYDYKDISIAVSGPKGLMVPV
MRNTENLSFRGVEDEVKRLALKARDGKITVDEMTGGTFTISNGGVFGSMLSTPIINPPQS
AILGMHNIVERPVAIDGHVEIRPIMYVALSYDHRIIDGKESVGFLVAVKEALENPEELLM
DNDVKRALEL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggctttagaaatgaaagtgccttcaccaggcgaatccataaccgaagttgaaatcgca
cagtggcttgttgaagatggcgactatgttgagaaagaccaagcaattgcagaagtagat
agtgacaaagcaacactagaacttcctgctgaagcaagcggtattattacacttaaagca
gaagaaggtgatgctgtcgaggttggtgcagttgtatgcttgatagatacagatgcaaaa
aaacctggtggtgatgacaaggctgctagtggtgatgaaggtagcggagacgatgccgaa
aaagaccttaaagaacaaaataaaaaaactgaggatactaatgaaaaaggtgatgctctt
aagcaaacaccttctaaacctagtactcaagaccagaaacaagataataagaactacgca
actggatctcctagtcctgccgctaagaaaatcttagatgaaaaaggaatggactctaaa
gatgttagtggctctggaagagacggccgcataactaaagatgatgctgtaaaggcaaaa
ccgtctatgggttctcctggaaatggaaaaagaggtgaaagccgcactaaattatctatg
cttcgtcgtaaagtagcagagcgtttagtttctgctaaaaatgagacagcaatgcttact
acttttaatgaagtagatatgtctccaatctttagcttgagaaaacaatataaagaagag
tttaaagcaaaacacggcgtaagtcttggctttatgtcattctttacacttgcttgtgtt
cgtgcattagaaatgtatcctgctgtaaattctatgattgaaggtaaggaaatgattacc
tatgattataaggatatatctattgcagtatctggaccaaaaggcttaatggtacctgta
atgagaaacacagaaaatttaagctttagaggcgtagaagatgaagtaaagcgtctggct
ttaaaagcaagagatggtaaaattactgtagatgaaatgacaggtggtacttttacaatc
tcaaacggaggcgtatttggaagtatgttaagtactcctataattaatcctccacaatct
gcaattttaggaatgcacaacattgttgagcgtccagttgctattgatgggcacgttgaa
attagacctataatgtatgtggcattatcttatgaccacagaattattgatggaaaagaa
tctgtaggtttccttgttgctgttaaagaggcattagaaaatccagaagaattattaatg
gataatgacgttaaacgcgctttagaattataa

DBGET integrated database retrieval system