KEGG   Croceibacter atlanticus: CA2559_02005Help
Entry
CA2559_02005      CDS       T01256                                 

Definition
2-oxoglutarate dehydrogenase complex, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cat  Croceibacter atlanticus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CA2559_02005
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CA2559_02005
  Amino acid metabolism
   00310 Lysine degradation
    CA2559_02005
Enzymes [BR:cat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CA2559_02005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
494707..495999
Genome map
AA seq 430 aa AA seqDB search
MALEMKVPSPGESITEVEIAQWLVEDGDYVEKDQAIAEVDSDKATLELPAEASGIITLKA
EEGDAVEVGAVVCLIDTDAKKPGGDDKAASGDEGSGDDAEKDLKEQNKKTEDTNEKGDAL
KQTPSKPSTQDQKQDNKNYATGSPSPAAKKILDEKGMDSKDVSGSGRDGRITKDDAVKAK
PSMGSPGNGKRGESRTKLSMLRRKVAERLVSAKNETAMLTTFNEVDMSPIFSLRKQYKEE
FKAKHGVSLGFMSFFTLACVRALEMYPAVNSMIEGKEMITYDYKDISIAVSGPKGLMVPV
MRNTENLSFRGVEDEVKRLALKARDGKITVDEMTGGTFTISNGGVFGSMLSTPIINPPQS
AILGMHNIVERPVAIDGHVEIRPIMYVALSYDHRIIDGKESVGFLVAVKEALENPEELLM
DNDVKRALEL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggctttagaaatgaaagtgccttcaccaggcgaatccataaccgaagttgaaatcgca
cagtggcttgttgaagatggcgactatgttgagaaagaccaagcaattgcagaagtagat
agtgacaaagcaacactagaacttcctgctgaagcaagcggtattattacacttaaagca
gaagaaggtgatgctgtcgaggttggtgcagttgtatgcttgatagatacagatgcaaaa
aaacctggtggtgatgacaaggctgctagtggtgatgaaggtagcggagacgatgccgaa
aaagaccttaaagaacaaaataaaaaaactgaggatactaatgaaaaaggtgatgctctt
aagcaaacaccttctaaacctagtactcaagaccagaaacaagataataagaactacgca
actggatctcctagtcctgccgctaagaaaatcttagatgaaaaaggaatggactctaaa
gatgttagtggctctggaagagacggccgcataactaaagatgatgctgtaaaggcaaaa
ccgtctatgggttctcctggaaatggaaaaagaggtgaaagccgcactaaattatctatg
cttcgtcgtaaagtagcagagcgtttagtttctgctaaaaatgagacagcaatgcttact
acttttaatgaagtagatatgtctccaatctttagcttgagaaaacaatataaagaagag
tttaaagcaaaacacggcgtaagtcttggctttatgtcattctttacacttgcttgtgtt
cgtgcattagaaatgtatcctgctgtaaattctatgattgaaggtaaggaaatgattacc
tatgattataaggatatatctattgcagtatctggaccaaaaggcttaatggtacctgta
atgagaaacacagaaaatttaagctttagaggcgtagaagatgaagtaaagcgtctggct
ttaaaagcaagagatggtaaaattactgtagatgaaatgacaggtggtacttttacaatc
tcaaacggaggcgtatttggaagtatgttaagtactcctataattaatcctccacaatct
gcaattttaggaatgcacaacattgttgagcgtccagttgctattgatgggcacgttgaa
attagacctataatgtatgtggcattatcttatgaccacagaattattgatggaaaagaa
tctgtaggtttccttgttgctgttaaagaggcattagaaaatccagaagaattattaatg
gataatgacgttaaacgcgctttagaattataa

DBGET integrated database retrieval system