KEGG   Croceibacter atlanticus: CA2559_02200Help
Entry
CA2559_02200      CDS       T01256                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cat  Croceibacter atlanticus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cat00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
530256..530852
Genome map
AA seq 198 aa AA seqDB search
MSKGGKLIVFSAPSGSGKTTIVRHLLKHQSLNLEFSISATSREPRFGEQDGVHYYFLDLS
EFKRRIKEDEFLEWEEVYRDNFYGTLKSEVERIWDEGKNVIFDIDVVGGLDIKEIYPEKT
LAVFVKPPSIEELKIRLKKRKTETEDKINMRVAKASIELKTAPQFDHIILNDNLDVALTK
AYNLVSDFVGADTNTTED
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaggaggaaaactcatagtattttcggcaccttctggaagtggaaaaactact
atagtaagacatttattaaaacaccaatcgttaaatcttgagttctccatttcggcaaca
tcaagagagccgcgctttggcgaacaagatggtgtacattattactttctagatctttca
gagtttaaacgccgaattaaagaagacgagtttttagaatgggaagaagtttatagagat
aacttttatggcacactaaagtctgaggtagaacgtatttgggacgaaggcaaaaatgta
atatttgatattgatgttgttggcggcctagatattaaagagatttatccagaaaaaaca
cttgccgtttttgtaaaacctccaagtatagaggagcttaaaattagacttaaaaaacgc
aaaacagaaacagaagacaagattaatatgagagttgcaaaagcttcaatagagctaaag
actgcaccacaatttgatcatattatacttaatgataatttagatgttgcacttacaaaa
gcatataatcttgtttcagattttgttggcgcagatactaatacaacagaagactag

DBGET integrated database retrieval system