KEGG   Croceibacter atlanticus: CA2559_03255Help
Entry
CA2559_03255      CDS       T01256                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cat  Croceibacter atlanticus
Pathway
cat00010  Glycolysis / Gluconeogenesis
cat00620  Pyruvate metabolism
cat00640  Propanoate metabolism
cat00680  Methane metabolism
cat01100  Metabolic pathways
cat01110  Biosynthesis of secondary metabolites
cat01120  Microbial metabolism in diverse environments
cat01130  Biosynthesis of antibiotics
cat01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CA2559_03255
   00620 Pyruvate metabolism
    CA2559_03255
   00640 Propanoate metabolism
    CA2559_03255
  Energy metabolism
   00680 Methane metabolism
    CA2559_03255
Enzymes [BR:cat01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CA2559_03255
Lipid biosynthesis proteins [BR:cat01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CA2559_03255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: EAP87740
UniProt: A3U673
Position
747718..749625
Genome map
AA seq 635 aa AA seqDB search
MSHYSIKHIEEYYQVYRKSVRDPELFWGEIAEEHFLWRKKWDRVLSYDFSKPEFKWFEGA
QLNITENCLDRHLTTRANKTALLFEPNNPEEKAQHITYKELYERVCKLANVLKQKGVKKG
DRVCIYLPMIPELTVSVLACARIGAIHSVVFAGFSSKALATRINDCDCEMVITSDGSYRG
HKTIDLKAIVDEALEQCSGVKNVLVVKRINSEVSMTPNRDFWIEPLLKEASANCPAEIMD
AEDPLFVLYTSGSTGTPKGMVHTCGGYMVYSAYTFKNVFRYEENDVYWCTADIGWITGHS
YIIYGPLANGATSLMFEGVPSYPDFGRFWEIVEKHRVNQFYTAPTAIRALAKENLKFIES
HDLSSLKVLGTVGEPINEEAWHWYNVNVGKKRSPVADSWFQTETGGIMISPIPYVTATKP
TYATLPLPGVQLALMDENGDEIKGNQVDGRLCIKYPWPGIARTIYGNHKRYKDTYFSAFK
GMYFTGDGALRDETGYYRITGRVDDVVIVSGHNMGTAPIEDAINEHPAVAESAIVGFPHD
IKGNALYGFITLKETGEGRDHNNLRSEINQLITEYIGPIAKLDKIQFTKGLPKTRSGKIM
RRILRKIASKDSENLGDISTLLNPEVVQDIIDTSL
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgagccattacagcataaaacatattgaagagtattatcaagtatatagaaaatctgtt
agagatcccgagctgttttggggtgaaatagccgaagaacattttttatggcgaaaaaaa
tgggatcgcgttttaagttatgattttagcaaacctgagtttaaatggtttgagggtgcc
caattaaatattacagaaaactgcttagacagacacttaaccacaagagcaaataaaacg
gcacttctttttgagccaaacaatcccgaagaaaaggcacaacatattacttacaaagag
ttgtatgagcgtgtttgtaagcttgcaaatgtcttaaaacaaaaaggggttaaaaaagga
gatcgcgtttgtatttatttacctatgatacctgagctcaccgtatctgtattggcttgt
gcaagaattggcgccatacactctgttgtttttgcagggttttcatctaaagctttagca
actcgaataaacgactgtgactgtgaaatggtcattacctcagatggatcttatagaggc
cacaaaacaatagatttaaaagcaattgtagatgaagcattagagcaatgtagtggcgtt
aaaaacgtattggtggttaaacgtattaattctgaggtctcaatgacacctaacagagat
ttctggatagaaccactgttgaaagaggctagtgcaaattgtcctgcagaaataatggat
gcagaagatccattatttgttttgtatacatctggatctacaggtacgccaaaaggaatg
gtacacacttgtggaggttatatggtatatagcgcctatacatttaaaaatgtgtttaga
tatgaagaaaatgatgtgtattggtgtacagcagatattggctggattacaggacacagt
tatataatttacggtcctttagccaatggtgccacttccttaatgtttgaaggtgtccct
agctacccagattttggaaggttttgggaaattgtagaaaagcatagagtaaatcagttt
tatactgcgccaacagcaattcgtgctttggcaaaagaaaaccttaaatttattgaaagt
cacgacctgtcttccttaaaagtattaggtactgttggagaaccaattaatgaagaggct
tggcattggtataatgttaatgtaggaaaaaaacgcagccctgttgcagattcgtggttt
caaacagaaactggtggtataatgatatctcctattccgtatgttacagcaacaaaacct
acatatgcaacattacctttgcctggagtacagttagcgttaatggacgaaaatggagat
gaaattaaaggcaaccaagtagatggccgtttgtgcataaaatatccttggcctggtata
gctcgtactatatatggaaaccataaacggtataaggacacctatttttcagcatttaaa
ggtatgtattttacaggtgacggtgcattaagagatgaaactggatattatagaattaca
ggacgcgttgatgatgttgtaattgtttccgggcataatatgggtactgcacctattgaa
gatgctattaatgaacacccagctgtagctgaaagtgctatagtaggtttccctcacgat
attaaaggaaatgcactgtatgggtttattactctaaaggaaactggagaaggaagagat
cacaataatcttaggtcagaaataaatcaattaatcaccgaatatataggtccaatagcc
aagttagataagattcaatttacaaaagggcttcctaaaacccgttcagggaaaattatg
cgccgtattttaagaaaaattgctagtaaagattctgaaaaccttggagacattagtacc
ttgctaaatcctgaagttgttcaagatataatagacacatctctataa

DBGET integrated database retrieval system