KEGG   Croceibacter atlanticus: CA2559_03635Help
Entry
CA2559_03635      CDS       T01256                                 

Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cat  Croceibacter atlanticus
Pathway
cat00860  Porphyrin and chlorophyll metabolism
cat01100  Metabolic pathways
cat01110  Biosynthesis of secondary metabolites
cat01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CA2559_03635
Enzymes [BR:cat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CA2559_03635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 PTSIIB_sorb RBD
Motif
Other DBs
NCBI-ProteinID: EAP87816
UniProt: A3U6E9
Position
complement(828406..829059)
Genome map
AA seq 217 aa AA seqDB search
MASILSTKILTRSQRELVLNTGFGLVEYNAINISFTKVSLPKRIENGIFTSQNAVAAIKD
KNIEIERVFCVGQNTRKALENLGYNVMLHAEHSRALGQKITIQYPEATFTFFCGNKRRDA
LPELLHKHNINLTEIEVYKTSLNIKEFQRTFNAIMCFSPSGVQSYFGANKPQKETIVCIG
NTTATAAKLYTDQIAIANTTSIESVIAKTVKVLNKTF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggctagtatattatctaccaaaattcttacgcgctcacaacgagagttggttttaaat
acaggatttggtctggtagaatataatgccataaacatttcatttacaaaggttagttta
ccaaaaaggatagagaacggtatttttactagtcaaaatgctgttgctgctataaaagac
aaaaatattgagattgaacgcgtgttttgtgtagggcaaaacactaggaaagctttagaa
aatctagggtataacgtcatgttacacgcggaacactctagagcgttgggacaaaaaatt
acaatacaatatcctgaagcaacgtttacttttttctgtggaaataaaagaagagatgca
ttaccagagctcttacacaaacataatataaaccttacggagatagaagtttacaaaaca
agtttaaacataaaagaattccaaagaacatttaatgccattatgtgttttagtcctagt
ggtgtacaaagttattttggagcaaataagccacaaaaagaaactattgtctgtattggt
aatactacagctacggcagcaaagctctatacagatcaaattgcaattgctaacacaacc
tcgattgaaagtgttatagcaaagacagtaaaggttttaaataagacattttga

DBGET integrated database retrieval system