KEGG   Croceibacter atlanticus: CA2559_04430Help
Entry
CA2559_04430      CDS       T01256                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cat  Croceibacter atlanticus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1008134..1009213
Genome map
AA seq 359 aa AA seqDB search
MKNFWFISIFALCLACSSDSSGEETITETPQDDEYIPVPDSNLNFQVPSNFPDATYDISN
NQPTQNGFELGKKLFYDGKLASDNVVSCGFCHIQDFAFTHHTHIVSHGVDGALGTRNAQP
LFNLAFLDEFTWDGAAQHLDTQPIIPITTDVEMNSSFNEIISKLSEDQTYQNMFKDAFDN
GEISSENILKALSQFMVMMVSSNSKYDQVVRNEGSVFTEAEEAGLAIFEQKCASCHAGPL
FTDQSFRNNGLPIDAQYNDIGRKRVTGLDEDLRKFRVPTLRNIEVTFPYMHDGRFQTLTD
VLDHYSDGVQEDVTLDPVFVQENGSRGIPLSNLEKDQLVAFLKTLTDNSFIFDDRFSEF
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaatttctggttcataagcatttttgcactctgtttagcgtgcagttcagattca
agtggtgaagaaacaattactgaaacaccacaggatgacgaatatattcctgtaccagat
tctaatttaaattttcaggtaccatctaattttccagatgctacttatgatataagtaac
aatcaacctactcaaaatggttttgagttagggaaaaagttattttatgacggaaaatta
gcctcagataatgttgtgtcttgtgggttttgccatattcaagattttgcatttacacac
cacacacatattgtaagtcatggtgtagatggagctttaggcacaagaaacgcacaacct
ttattcaatttagcgttcttagatgagtttacttgggatggtgcagcacaacatttagac
acacaacctattataccaatcactacagatgtagagatgaactcaagctttaatgagata
atctcaaaattaagtgaagaccaaacctatcaaaacatgtttaaagatgcgtttgataat
ggtgaaattagctcggaaaacattttaaaggcattatctcagtttatggttatgatggta
tcttcaaattcaaaatacgatcaagttgtaagaaatgaaggttcagtctttacagaagca
gaagaagcaggcttggctatattcgaacaaaaatgtgcctcttgccatgcaggtccgcta
tttacagaccaatcttttagaaataatggattgcctattgatgcgcaatataatgacata
ggaagaaaacgtgtaacaggactagatgaagacctgcgtaagtttagagttcctacatta
agaaatatagaggttacctttccgtatatgcacgacggcaggtttcaaacccttacagat
gtgctagaccattattcagatggtgttcaggaagatgttacattagacccagtttttgtt
caggaaaatggttctagaggaattccactttcaaatttagaaaaagatcaattggtggct
tttttaaaaacacttacagataacagttttatctttgatgatcgcttttcagaattttaa

DBGET integrated database retrieval system