KEGG   Croceibacter atlanticus: CA2559_05110Help
Entry
CA2559_05110      CDS       T01256                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cat  Croceibacter atlanticus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CA2559_05110
   01230 Biosynthesis of amino acids
    CA2559_05110
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CA2559_05110
   00030 Pentose phosphate pathway
    CA2559_05110
   00051 Fructose and mannose metabolism
    CA2559_05110
   00052 Galactose metabolism
    CA2559_05110
  Energy metabolism
   00680 Methane metabolism
    CA2559_05110
Enzymes [BR:cat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CA2559_05110
Protein phosphatases and associated proteins [BR:cat01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CA2559_05110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1160719..1161705
Genome map
AA seq 328 aa AA seqDB search
MKDKLNHIAVLTSGGDAPGMNAGIRAVVRSCAFHDIKCSGIYRGYQGLIENDFEVLNARS
VRNIINRGGTFLKSARSKEFRTKEGRQKAYENLISQGVDALVVIGGDGTFNGAVVFNEEH
DFPIVGMPGTIDNDINGTDHTIGYDTALNTVVEAIDKIRDTANSHNRLFLVEVMGRDAGD
IALNAGIGAGAEEILIPEEDLGTDRLLESLKRSKKSGKTSSIIVVSEGDKIGKNIFELAE
FIETNLEDYEVRVTVLGHIQRGGTPSCYDRVLASRLGIGAVDALLAGERDIMIGTVHGKV
TSVPFKEAVAGRNKIDLDLIRVADITST
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataaattgaatcatattgctgtcctaacaagtggtggcgatgctccaggaatg
aatgcaggaataagagcagttgtacgttcttgtgcatttcacgatattaaatgttctggt
atttatagaggttaccaaggtcttatagaaaatgattttgaagttcttaatgcacgttca
gtaagaaatattataaatcgaggtggcacctttttaaaatcggcacgttctaaagaattt
aggacaaaagaaggacgtcaaaaagcttacgaaaatcttatatctcaaggcgtagatgcc
ttggtggtaattggaggtgatggtacatttaatggtgcagttgtctttaatgaagaacat
gattttccaatagtaggaatgccaggtactatagataatgatattaatggaacagatcat
actattggttacgatactgcattaaatactgttgttgaagctatagataaaattagagat
accgcaaactctcataaccgtttgtttttagttgaggttatgggaagagatgcaggagat
attgccttaaatgcaggtattggtgcaggagcagaagagattttaattccggaagaagat
ttaggaacagatagattgttagagtctttaaaacgaagtaaaaaatctgggaaaacctcc
agcattattgtggtttctgaaggagataaaataggtaagaatatttttgaactcgcagag
tttattgaaaccaacctagaagattacgaagttagagttactgttttaggacacatacaa
cgtggtggtacgcctagctgttatgatcgtgttttagcaagcaggttaggtattggtgcc
gtagatgcattattggcaggagagcgagacattatgataggaacagtgcacggtaaagtt
acatctgtgccatttaaggaagctgttgcaggacgcaataaaatagatttagatttaatt
agagtggcagatattacttcgacataa

DBGET integrated database retrieval system