KEGG   Croceibacter atlanticus: CA2559_05495Help
Entry
CA2559_05495      CDS       T01256                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cat  Croceibacter atlanticus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cat00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:cat00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:cat02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1239361..1241385)
Genome map
AA seq 674 aa AA seqDB search
MKHILLLGFLIIVLSSKGQNIQYQRSSNNLATQSSTAVFNEDLQPFYHGVASGDPLSDRV
IIWTRVTPENNETTIDVQWRVATDIEFTNVVLQGATTTDATVDYTVKVDAIGLNPATTYY
YHFFALERSSIIGRTRTAPSADADQLRFAITSCSNYQAGYFNAYKKIAQRQDLDAVIHLG
DYIYEYGSGPGTYGYSAERPDRANEPSNEIISLVDYRTRYSLYRLDPDLRAVHQQHPFIT
IWDDHESTNDSYKDGAENHNDGEGEWEDRKAISKQVYFEWLPIRNHPDNKISRTLNYGNL
ATIINLDTRLEGRELQIDDVNDPELYNVNRTMLGEPQRDWFFDELSNSTAKWKIVSNQVM
LAEFNLGWASGGLGLGGDELESSFLDIWDGYPAERDKILDHIQDNNINDVVFLTGDIHTS
FSYDVSKRPTDNHPDADNQDFMVDYDPNTGNGSIAVEFVGPSVTSDNFDEVLTAAGSAYI
ASGINQSSVANGFSNPNPHMKYTNLNDHGYYILDLTNTKAQADYYFIDILNSDSNTEAFD
EGWFTNTLDNHLTQATEAAPEKNEQPELAPVEVPDFGTLSNDEFTSKDLAVFSLYPNPLY
SNNILYLQYGVKNDTRIKISLYNLQGKQVHTFYNKETPQGIFFSGFTLPAIANGNYILNI
STRDTTISKQIIIK
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatattttactattaggttttctaataattgtactttcatcgaaaggacaaaac
attcaataccaacgttcctcaaacaatttagccacacaatcttctacagcagtatttaat
gaagatttacaaccattttatcatggcgttgcctctggtgatccgctttcagatcgtgtt
ataatttggactcgtgtaactccagaaaacaatgagacaactattgatgtgcaatggaga
gttgctacagatatagaatttacaaatgtagtgttacaaggagctaccactacagatgca
actgtagattatactgtaaaagtagatgctattggtcttaatcctgcaactacatactac
tatcacttttttgctttagaaagaagctcaatcataggtagaactagaacagcaccaagt
gcagatgcagatcaactaaggtttgctataacaagctgctcaaactatcaagcaggatat
tttaatgcgtataagaaaattgcccaacgccaagacttagatgctgttatacatttagga
gactatatttatgaatatggttcaggacctggaacatatggttatagcgcagaaagacca
gatagagcaaatgaaccttctaatgaaattatttctttagtagattacagaacacgttac
tcattatataggttagatccagatttaagagctgtgcaccaacaacacccattcattaca
atttgggatgaccacgaaagcactaatgacagttacaaagatggtgcagaaaaccataat
gatggtgaaggcgaatgggaagaccgcaaagccatttctaaacaggtttatttcgaatgg
ttgcctataagaaatcatccagataataaaatttcaagaacacttaattatggtaatctt
gcaactataattaacttagacacacgccttgaaggcagagaactacaaatagatgatgta
aacgatccagaattatacaatgtaaatcgcacaatgcttggtgagccacaaagagattgg
ttctttgatgaactaagcaactcaaccgcaaaatggaaaatagtctctaaccaagtaatg
cttgctgaatttaacttaggctgggcttctggtggtttagggttaggtggtgatgaactt
gagagttccttcttagatatatgggatggatatcctgcagaacgagataaaattttagat
catatacaagacaacaatattaatgatgtcgtttttttaactggagatattcacacttcg
ttttcttatgatgtttctaagaggccaacagacaaccatccagatgcagataaccaagac
tttatggttgattatgatccaaataccggaaatggatctatagcagttgaatttgttgga
ccaagtgttacttcagataattttgatgaagttttaactgcagcaggatctgcctatatt
gcttctggcataaaccaatcaagcgttgctaacggtttttctaatcctaatccgcacatg
aaatatactaacctaaacgatcacggttactatatactagacttaactaacactaaagca
caggcagattactactttatagatatattgaattctgactctaacactgaagcttttgat
gaaggttggtttacaaatacgttagataaccacctaacacaagcaactgaagccgcacca
gaaaaaaatgaacaaccagaattagcacctgttgaagttccagattttggtacactttca
aatgatgagtttacttcaaaagatttagcagtatttagcctataccctaacccactttat
agtaacaacattttatacttacaatatggtgttaagaatgataccagaataaaaataagt
ttatacaacttacaaggtaaacaagttcacacattttataataaggagacgccacaagga
attttctttagcggttttacattaccggcaatagctaatggtaactatattttaaacatt
tcaacaagagacactaccatttcaaaacaaattattatcaagtaa

DBGET integrated database retrieval system