KEGG   Croceibacter atlanticus: CA2559_06380Help
Entry
CA2559_06380      CDS       T01256                                 

Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cat  Croceibacter atlanticus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cat00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CA2559_06380
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CA2559_06380
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CA2559_06380
Enzymes [BR:cat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CA2559_06380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1423158..1424351)
Genome map
AA seq 397 aa AA seqDB search
MTITQSYQVNEKGYYGDFGGAYIPEMLYPNVEELRSQYLKIMDDADFKAEFKKLLKDYVG
RPTPLYFAERLSKHYNTKIYLKREDLCHTGAHKVNNTIGQILMAKRLGKHRIIAETGAGQ
HGVATATVCALMGLECIVYMGAIDIERQAPNVARMKMLGATVIPAESGSKTLKDATNEAI
RDWINNPTDTHYIIGSVVGPHPYPDMVARFQSVISAETRLQLQEKEGTELPDHVVACVGG
GSNAAGLYYNFLDEPSVNIIAVEAAGKGVNSGESAATSALGKEGIIHGSKTLLMQTDDGQ
ITEPYSISAGLDYPGVGPMHAHLYKSGRAEFISVTDEAAMKAGLFLSKTEGIIPAIETSH
ALSIFETRAFKPDEIVVVNLSGRGDKDLNTYIDYFGY
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaataacacaatcttaccaagtaaacgaaaaaggctattatggcgattttggtggt
gcctatattccagaaatgctatatcccaatgtagaagagttacgctctcaatatcttaag
attatggatgatgccgactttaaagcagagtttaaaaaactgcttaaagattatgtgggc
aggccaacacctttatattttgcagagcgcctttctaagcattacaacacaaagatttat
ttaaaacgtgaagatttgtgtcatacaggagctcacaaggtaaacaatactattgggcaa
atccttatggctaaacgtttgggtaaacataggattattgcagaaaccggtgccggacaa
catggtgtggcaacagctaccgtttgtgcacttatggggttggagtgtattgtatatatg
ggcgctatagatattgagcgccaagcaccaaatgtggcacgtatgaaaatgttgggcgct
acggtaataccagcagagtctggcagcaaaaccttaaaagatgccacaaatgaagccata
agagattggattaacaatcctacagatacacattatattataggatctgtagttggacca
cacccatatccagatatggtggcacgttttcaaagtgtgatatctgcagaaaccaggtta
cagttacaggaaaaagaaggtacagaattgccagatcacgttgttgcttgtgtaggtggt
ggtagtaatgcggcaggattatattataactttttagatgagcctagtgtaaatattata
gctgttgaagctgctggaaaaggagtaaattctggagaaagcgccgcaacatctgcctta
ggtaaagaaggcattatacacggaagcaaaacacttttaatgcaaaccgatgatgggcaa
attactgaaccctactctatttctgcaggcttagattatcctggcgttggaccaatgcac
gctcatttatataaaagtggccgagcagaatttattagcgttacagatgaagctgctatg
aaagcaggtttgtttctttctaaaaccgaaggcataataccagctattgaaacctctcac
gcactttctatttttgaaactagagcctttaagcccgatgagattgttgtggtaaactta
agtggtcgtggtgataaagacttaaatacctatatagattattttggctattaa

DBGET integrated database retrieval system