KEGG   Croceibacter atlanticus: CA2559_06390Help
Entry
CA2559_06390      CDS       T01256                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cat  Croceibacter atlanticus
Pathway
cat00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cat01100  Metabolic pathways
cat01110  Biosynthesis of secondary metabolites
cat01130  Biosynthesis of antibiotics
cat01230  Biosynthesis of amino acids
Module
cat_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cat00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CA2559_06390
Enzymes [BR:cat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CA2559_06390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: EAP88367
UniProt: A3U800
Position
complement(1425085..1425867)
Genome map
AA seq 260 aa AA seqDB search
MKTILDDIIANKISELNLKKQVVPASQFEKMALFHRKTVSITSAIRNGSGIIAEFKRRSP
SKPAINMNARVQNVTLGYQEAGASAISVLTDNKFFGGSLDDLLLARASVTIPVLRKDFII
EEYQILEAKANGADVILLIAAALRKQELKNLSKFAQSLGLEVLLEVHNEEELEKSLLPSV
NLLGVNNRNLKTFETNINTSKELSKRIPNDFVRVSESGISSPKTITELKAYGFEGFLIGE
QLMKTNSPYDDTKTFIDAIH
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccattttagacgatataattgcaaataaaatatctgaacttaatttaaaaaag
caagttgttcctgctagccagtttgagaaaatggcattgtttcaccgcaagactgtatct
ataactagtgcaatacgaaacggttctggcattattgcagagtttaaaagacgatctccg
agcaagcctgccataaatatgaatgctcgcgtacaaaatgtaaccttaggctatcaagaa
gctggtgcaagtgccatttctgtattaacagacaataaattttttggtggttctttagat
gatcttttgttagcaagagcaagtgtgaccatacctgtacttcgtaaagattttattatt
gaagaataccaaatattagaagcaaaggccaatggcgcagatgttatcttacttatagct
gcagcattacgaaagcaagaacttaaaaacctgtctaagtttgcgcaatctttaggatta
gaggttctcttagaagttcacaatgaagaagagttagaaaaatctctattaccatctgta
aacttattaggtgtaaacaacaggaacctaaaaacttttgaaaccaatattaataccagc
aaagaactgtctaaacgcattcctaatgattttgtacgtgtttctgaaagcggtattagc
tccccaaaaacaattacagaattaaaggcatatgggtttgaagggtttttaattggtgaa
cagcttatgaaaaccaattcgccttatgatgatactaaaacatttatagacgctattcac
taa

DBGET integrated database retrieval system