KEGG   Croceibacter atlanticus: CA2559_06815Help
Entry
CA2559_06815      CDS       T01256                                 

Definition
asparagine synthetase B, glutamine-hydrolyzing protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cat  Croceibacter atlanticus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cat00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CA2559_06815
Enzymes [BR:cat01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CA2559_06815
Peptidases [BR:cat01002]
 Cysteine Peptidases
  Family C44
   CA2559_06815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1517252..1518940
Genome map
AA seq 562 aa AA seqDB search
MCGIVCAFDLKEKSEVLRPQVLEMAKAIRHRGPDWSGIYSDDKVIMAHERLAIVDPASGK
QPLLSDDRKLILAANGEIYNHRELRKQFEGKYDFKTESDCEVILALYKEKGVDFIDDMNG
IFGFAIYDAEKDEYFVARDHMGIIPLYIGWDQNGTFYVASELKALEGVCSKIQLFPPGHY
MSSKDGKFVKWYKRDWTEFDAVKDNETSIAKIKEALEAAVQRQLMSDVPYGVLLSGGLDS
SVTSAIAKKYAQKRVESDGKKDAWWPQLHSFSVGLEGSPDLAAARKVADHIDTVHHEIKF
TIQEGLDAIRDVIYNLETYDITTIRASTPMYLMARVIKSMGIKMVLSGEGADELFGGYLY
FHKAPNAQEFHEETVRKLSKLHMYDCLRANKSLAAWGIEGRVPFLDKEFMDVAMSINPQD
KMINGERMEKWVVRKAFEDMIPESVAWRQKEQFSDGVGYSWIDTLKEMVNDLITDEQMAN
AHFRFPIQTPQNKEEFYYRSIFEEHFPSDAAALCVPQEPSVACSTKIALEWDEAFKDMND
PSGRAVAKVHDDAYQEKEAVAV
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatagtatgcgcattcgatttaaaagaaaagtctgaagttttaagacctcaa
gtgttagaaatggcaaaagctatacgtcatcgtggtccagattggagcggtatttatagc
gatgataaggttataatggctcacgaaagattggctattgtagatccagcatctggtaaa
caaccgttattgagtgatgatcgtaaacttatattagctgcgaatggagagatttacaac
catagggaattacgtaagcagtttgaaggaaagtatgattttaaaactgaaagtgactgc
gaggttattttagctttatataaggaaaaaggagttgactttatagacgatatgaatggc
atttttggttttgctatttatgatgcggaaaaggatgaatatttcgtggctagagaccat
atgggaattattccattatatattggttgggatcaaaacggaacattttacgtagcttca
gaattaaaggcgttagaaggtgtttgttctaaaattcaattatttcctccaggacattat
atgtctagtaaagacggaaaatttgtaaaatggtataaaagagattggacagaatttgat
gctgtaaaagataatgaaactagcattgctaaaattaaagaggcgctggaagctgctgta
caaagacagttaatgagtgatgtgccatatggtgtattgctttctggcggattagactcc
tctgtaacatctgcaatagcaaaaaaatatgctcaaaaaagagtagaaagtgatggtaaa
aaagatgcttggtggccacaactgcatagtttttctgtaggtttagagggttctccagac
ttagctgctgcacgcaaagttgcagaccatatagatacagtacatcacgaaattaaattc
acaatccaagaaggtttagatgcaataagagatgttatttacaatctcgaaacatatgac
ataacaacaatacgtgcaagtacgccaatgtatttaatggcacgtgtcattaagtctatg
gggataaaaatggtgctgtctggtgaaggtgcagatgagttgtttggtggctatttatac
tttcacaaggctccaaatgctcaagagtttcacgaagaaactgttcgtaaattaagtaaa
ctacacatgtatgattgcttgcgtgctaataagagtttagcggcttggggaattgaaggt
cgtgtaccatttttagataaagagtttatggatgttgcaatgagtataaacccacaagat
aaaatgattaatggtgagcgtatggaaaagtgggtagtacgtaaagcgtttgaagatatg
ataccagaaagtgtggcgtggagacaaaaagagcagtttagtgatggtgttggttacagt
tggatagatactttaaaagaaatggtaaacgatttaataacagatgaacaaatggcaaat
gcacattttagattccctatacaaacgcctcaaaacaaagaggagttttattaccgtagt
atttttgaagagcatttccctagtgacgctgcggcactttgtgttcctcaggagccaagt
gtggcgtgtagtactaaaattgctttagagtgggatgaagcatttaaagatatgaatgat
cctagtggtagagctgttgccaaagttcatgatgatgcttaccaagaaaaagaagctgta
gcagtataa

DBGET integrated database retrieval system