KEGG   Croceibacter atlanticus: CA2559_07410Help
Entry
CA2559_07410      CDS       T01256                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cat  Croceibacter atlanticus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cat00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CA2559_07410
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CA2559_07410
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CA2559_07410
Enzymes [BR:cat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CA2559_07410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1641475..1642836)
Genome map
AA seq 453 aa AA seqDB search
MLKQGILKKFPHKNGITITQFMTYYSLNGKAKQVNFETAVRKGLAEDKGLYFPDHISALP
KSFYDAIENLSPTEIGYHVIKQFVGDEIPENDLKIIISETLDFKFPVVSVEENVGSLELY
HGPTLAFKDVGARFMARCLGYFNTSQKNTEKVTVLVATSGDTGGAVANGFYNVEGVNVVI
LYPSGKVSHIQEQQLTTLGGNIEAIEVDGTFDDCQAMVKKAFLDKDFKGKRNLTSANSIN
VARWLPQMFYFFLAYKQLKSLDKKLVFSVPSGNYGNICAGMMAQKLGLPISHFVAGTNEN
DIVPEYLKTGIYTAKPSVATISNAMDVGDPSNFIRIQKIHDNDDTTLKQHLSAYRYSDTE
TEDAMIQLYKTHNYIADPHGAIGYLALKKYQESNPDTYGVFLETAHPCKFLDVIPKSIVD
AVNIPKSIKAIMDKEKKSTLLITYTELKEYLLK
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaagcaaggaatactaaagaagtttccgcataaaaacggaataacaattacacag
tttatgacctattatagtttaaacggaaaagcaaaacaagtaaactttgaaactgcagta
cgtaaaggcttggcagaagataaaggcttgtattttcctgatcatatttcagcattacca
aaatcattttatgatgccattgaaaatttatcacctaccgaaatcggttatcatgttatc
aaacaatttgtaggagatgaaattccagaaaacgatttaaaaattataatttctgaaaca
ttagattttaaatttcctgttgtatctgttgaagaaaatgtaggatcactagagttgtat
catggtcctactttggcatttaaagatgtgggtgctcgctttatggcacgttgcttaggg
tattttaatacctctcaaaaaaatacagaaaaagtaaccgtacttgttgccacttctgga
gatacaggcggcgcagttgcaaatggcttttataatgttgaaggtgtaaatgttgttata
ctctaccctagcggaaaagtgagccatatacaagaacagcaacttacaaccttgggagga
aatattgaagctattgaagttgatggcacgtttgacgattgccaagcaatggtgaagaaa
gcatttttagataaagactttaaggggaaacgcaacttaacctcagcaaactcaataaat
gtggcgcgttggttaccacaaatgttctatttctttttggcttataaacaattaaagtct
ctggataagaagcttgtattttcagtaccaagtggtaattacggaaatatctgtgctgga
atgatggcgcaaaaactgggtttaccgatatcccattttgttgctggaactaacgagaat
gacatagttccagaatatttaaaaactggaatctataccgcaaaaccatctgtagcaaca
attagtaatgccatggatgttggcgacccaagtaattttatccgcattcaaaaaattcac
gataatgatgatacgaccttaaaacaacatctttcagcgtatcgttatagtgatactgaa
actgaagatgctatgattcagctatataaaacacataattatatagcagatcctcacggc
gcaattggatatttagcgctgaaaaaatatcaagaatcgaatcctgatacctatggtgtg
tttctagaaaccgcgcatccttgtaagtttttagatgtgataccgaagtcaatagttgat
gctgttaatattccgaagagtattaaagcgattatggataaagagaaaaaatctacatta
ttaattacgtataccgagttaaaggagtatctcttaaagtaa

DBGET integrated database retrieval system