KEGG   Croceibacter atlanticus: CA2559_07580Help
Entry
CA2559_07580      CDS       T01256                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cat  Croceibacter atlanticus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cat03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1685316..1685933
Genome map
AA seq 205 aa AA seqDB search
MDFSSKYLEQAVQEVSQLPGIGKRTALRLVLHLLKQPEDQTVSLAKALVDVKTQINFCTN
CHNISDHKLCEICANPKRESQYVCVVEDIRDVMAIENTSQYRGHYHVLGGKISPMDGVGP
NQLNISTLVDKAKAGKVDEIIFALSSTLEGDTTNFYIFKQLEGTGIKTSTIARGISVGDE
LEYADEITLGRSILNRIPFEASLKS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggatttttcttcaaaatatttagaacaagcagttcaggaagtctctcaattaccagga
attggaaagcgtacagcgttgcgtttggtacttcatttattaaaacagccagaagaccaa
acggtaagtttggctaaggctttggtagatgttaagacacaaataaatttctgcactaac
tgtcataatataagtgatcataagctttgtgagatttgtgcaaatcctaaaagagaatca
caatatgtttgtgttgttgaagatataagagacgtaatggcaattgagaatacaagccaa
tatcgtggtcactatcacgtcttaggtggaaaaataagtcctatggatggtgtgggtcca
aaccaattaaatatttctaccttggtagacaaggctaaagcaggaaaagtagatgaaatt
atatttgctttaagcagtacgttggaaggagacactactaacttttatatttttaaacaa
ttagaaggaacaggtataaaaacctctaccattgcaagagggatttctgtaggagatgag
ttggagtatgcagatgagatcaccttaggtagaagtatcctaaatagaattccttttgaa
gcttctttaaaatcttaa

DBGET integrated database retrieval system