KEGG   Croceibacter atlanticus: CA2559_07580Help
Entry
CA2559_07580      CDS       T01256                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cat  Croceibacter atlanticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cat00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CA2559_07580
DNA repair and recombination proteins [BR:cat03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CA2559_07580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1685316..1685933
Genome map
AA seq 205 aa AA seqDB search
MDFSSKYLEQAVQEVSQLPGIGKRTALRLVLHLLKQPEDQTVSLAKALVDVKTQINFCTN
CHNISDHKLCEICANPKRESQYVCVVEDIRDVMAIENTSQYRGHYHVLGGKISPMDGVGP
NQLNISTLVDKAKAGKVDEIIFALSSTLEGDTTNFYIFKQLEGTGIKTSTIARGISVGDE
LEYADEITLGRSILNRIPFEASLKS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggatttttcttcaaaatatttagaacaagcagttcaggaagtctctcaattaccagga
attggaaagcgtacagcgttgcgtttggtacttcatttattaaaacagccagaagaccaa
acggtaagtttggctaaggctttggtagatgttaagacacaaataaatttctgcactaac
tgtcataatataagtgatcataagctttgtgagatttgtgcaaatcctaaaagagaatca
caatatgtttgtgttgttgaagatataagagacgtaatggcaattgagaatacaagccaa
tatcgtggtcactatcacgtcttaggtggaaaaataagtcctatggatggtgtgggtcca
aaccaattaaatatttctaccttggtagacaaggctaaagcaggaaaagtagatgaaatt
atatttgctttaagcagtacgttggaaggagacactactaacttttatatttttaaacaa
ttagaaggaacaggtataaaaacctctaccattgcaagagggatttctgtaggagatgag
ttggagtatgcagatgagatcaccttaggtagaagtatcctaaatagaattccttttgaa
gcttctttaaaatcttaa

DBGET integrated database retrieval system