KEGG   Croceibacter atlanticus: CA2559_08026Help
Entry
CA2559_08026      CDS       T01256                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cat  Croceibacter atlanticus
Pathway
cat00260  Glycine, serine and threonine metabolism
cat00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cat01100  Metabolic pathways
cat01110  Biosynthesis of secondary metabolites
cat01130  Biosynthesis of antibiotics
cat01230  Biosynthesis of amino acids
Module
cat_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cat00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CA2559_08026
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CA2559_08026
Enzymes [BR:cat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CA2559_08026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA HMGL-like
Motif
Other DBs
NCBI-ProteinID: EAP85964
UniProt: A3UBG3
Position
complement(1760621..1761382)
Genome map
AA seq 253 aa AA seqDB search
MNRIHKTLAEDKTLLSIYFTAGYPELNDTVTIIKSLEDSGVDMIEIGLPFSDPLADGPTI
QESSTKALQNGMTTKLLFEQLRDIRSQVSIPLIIMGYFNPMLQFGFEAFCKECEAIGIDG
LIVPDLPLAEYEDHYKGIFEKHNLSNVFLITPQTSDERIKQIDEASNAFIYMVSSASVTG
STSGFGEAQQSYFKRIKDLNLTNPQIVGFGIKDEQTFKDATANAKGAIIGSAFIKHLTKE
GVANIPQFVKTIR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaatacacaaaacattagctgaagacaaaacacttttgtctatttactttaca
gcaggttatccagaactaaacgatactgttacaatcataaaatcactcgaagatagcggt
gtagatatgattgaaatcggtttaccttttagtgatcctttagcagatggacctaccata
caagaaagttcaacaaaagcattgcaaaatggtatgactaccaaacttttgtttgagcaa
ttaagagatataagatctcaagtttctatccctttaattattatgggatactttaatcct
atgttgcaatttgggtttgaagcattttgtaaagaatgtgaagcaataggtattgatggc
ttaattgtcccagatttaccattagcagaatatgaagaccattataaagggattttcgaa
aaacacaacctttccaatgtattcttaattactccacaaacatcagatgagcgtataaag
caaatagatgaggcttcaaacgcttttatttatatggtgagttcagcaagtgttacaggt
agtacaagcggatttggagaagcgcagcaatcttattttaaaagaattaaagatttaaat
ttaacaaatccacaaattgttggatttgggattaaagatgagcaaacctttaaagatgct
actgcaaatgctaaaggagcaattataggatctgcatttataaaacatcttactaaagaa
ggtgttgcaaatattcctcaatttgttaaaaccataagatag

DBGET integrated database retrieval system