KEGG   Croceibacter atlanticus: CA2559_08536Help
Entry
CA2559_08536      CDS       T01256                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cat  Croceibacter atlanticus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CA2559_08536
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CA2559_08536
   00640 Propanoate metabolism
    CA2559_08536
   00660 C5-Branched dibasic acid metabolism
    CA2559_08536
Enzymes [BR:cat01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CA2559_08536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1869918..1871111
Genome map
AA seq 397 aa AA seqDB search
MNLHEYQGKEILSSFGVEIQRGIVAQTPQEAVEAAKKLTEQTGTGWHVIKAQVHAGGRGK
GGGVKLAKNLQEVESISNDIIGMNLVTPQTSKEGKKVHQVLVAEDVYYPGDSEPEEYYMG
VLLNRATGKNMVMYSTEGGMDIETVAEETPHLIFTEEIDPATGLQGFQARKIAFNLGLKG
QAFKQMTKFVTALYKAYMESDSSMFEINPVLKTSDDKIIAVDAKVTLDENALFRHKDYAA
MRDIREENPTEVEAKEVGLNYVDLDGNVGCMVNGAGLAMATMDLIKQAGGSPANFLDVGG
TADAARVEAAFRLILKDPEVKAILINIFGGIVRCDRVAQGVVDAYKAMGDAVKVPIIVRL
QGTNADIAKELIDNSGLPVQSAIEFKEAADKVQAVLA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacacgaatatcaaggaaaagaaatattaagcagttttggcgttgagatacaa
cgcggtattgtggcacaaactccacaagaagctgttgaggcagcaaagaaattaacagag
caaaccggaacaggttggcacgtgattaaagcacaggttcacgctggtggccgtggtaaa
ggtggcggtgttaagttggctaaaaaccttcaagaggtagaaagcatttctaatgatatc
atcgggatgaatttggtaactcctcaaacttctaaagaaggtaaaaaggtacaccaagta
ttagttgcagaagatgtttactatcctggcgatagtgaaccagaagaatattatatgggt
gtgcttttaaatagagcaacaggtaaaaatatggtaatgtattctacagaaggtggaatg
gatattgaaactgtagccgaagaaacaccacacttaatttttacagaagagatagatcct
gcaactggactacaaggttttcaagctcgtaaaatagcttttaacctaggtcttaaagga
caggcatttaaacaaatgacaaagtttgttactgcattatacaaagcatatatggaatct
gattcttctatgtttgaaattaatccagttttaaaaactagtgacgataaaattattgct
gttgatgcaaaagtaactttagatgagaatgcattgttccgtcataaagattatgcagca
atgcgtgacataagagaagaaaatcctacagaagttgaagctaaagaagttggtcttaac
tatgtagatctagatggtaatgttggctgtatggttaacggtgctggattggcaatggca
actatggatttaattaagcaagctggtggttctcctgctaacttcctagatgttggaggt
actgcagatgctgctagagtagaggctgcttttagattaatcttaaaagatccagaagta
aaagctatcttaataaacatttttggaggtattgtacgttgtgaccgtgtggcacaaggt
gttgtagatgcttacaaagcaatgggagatgcggtaaaagtaccaatcattgtacgttta
caaggaactaacgcagacatagcaaaagaacttatagacaatagtggtttaccagtacaa
agtgctatcgagtttaaagaagctgcagataaagtacaagctgtattagcatag

DBGET integrated database retrieval system