KEGG   Croceibacter atlanticus: CA2559_08536Help
Entry
CA2559_08536      CDS       T01256                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cat  Croceibacter atlanticus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CA2559_08536
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CA2559_08536
   00640 Propanoate metabolism
    CA2559_08536
   00660 C5-Branched dibasic acid metabolism
    CA2559_08536
Enzymes [BR:cat01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CA2559_08536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1869918..1871111
Genome map
AA seq 397 aa AA seqDB search
MNLHEYQGKEILSSFGVEIQRGIVAQTPQEAVEAAKKLTEQTGTGWHVIKAQVHAGGRGK
GGGVKLAKNLQEVESISNDIIGMNLVTPQTSKEGKKVHQVLVAEDVYYPGDSEPEEYYMG
VLLNRATGKNMVMYSTEGGMDIETVAEETPHLIFTEEIDPATGLQGFQARKIAFNLGLKG
QAFKQMTKFVTALYKAYMESDSSMFEINPVLKTSDDKIIAVDAKVTLDENALFRHKDYAA
MRDIREENPTEVEAKEVGLNYVDLDGNVGCMVNGAGLAMATMDLIKQAGGSPANFLDVGG
TADAARVEAAFRLILKDPEVKAILINIFGGIVRCDRVAQGVVDAYKAMGDAVKVPIIVRL
QGTNADIAKELIDNSGLPVQSAIEFKEAADKVQAVLA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacacgaatatcaaggaaaagaaatattaagcagttttggcgttgagatacaa
cgcggtattgtggcacaaactccacaagaagctgttgaggcagcaaagaaattaacagag
caaaccggaacaggttggcacgtgattaaagcacaggttcacgctggtggccgtggtaaa
ggtggcggtgttaagttggctaaaaaccttcaagaggtagaaagcatttctaatgatatc
atcgggatgaatttggtaactcctcaaacttctaaagaaggtaaaaaggtacaccaagta
ttagttgcagaagatgtttactatcctggcgatagtgaaccagaagaatattatatgggt
gtgcttttaaatagagcaacaggtaaaaatatggtaatgtattctacagaaggtggaatg
gatattgaaactgtagccgaagaaacaccacacttaatttttacagaagagatagatcct
gcaactggactacaaggttttcaagctcgtaaaatagcttttaacctaggtcttaaagga
caggcatttaaacaaatgacaaagtttgttactgcattatacaaagcatatatggaatct
gattcttctatgtttgaaattaatccagttttaaaaactagtgacgataaaattattgct
gttgatgcaaaagtaactttagatgagaatgcattgttccgtcataaagattatgcagca
atgcgtgacataagagaagaaaatcctacagaagttgaagctaaagaagttggtcttaac
tatgtagatctagatggtaatgttggctgtatggttaacggtgctggattggcaatggca
actatggatttaattaagcaagctggtggttctcctgctaacttcctagatgttggaggt
actgcagatgctgctagagtagaggctgcttttagattaatcttaaaagatccagaagta
aaagctatcttaataaacatttttggaggtattgtacgttgtgaccgtgtggcacaaggt
gttgtagatgcttacaaagcaatgggagatgcggtaaaagtaccaatcattgtacgttta
caaggaactaacgcagacatagcaaaagaacttatagacaatagtggtttaccagtacaa
agtgctatcgagtttaaagaagctgcagataaagtacaagctgtattagcatag

DBGET integrated database retrieval system