KEGG   Croceibacter atlanticus: CA2559_08636Help
Entry
CA2559_08636      CDS       T01256                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cat  Croceibacter atlanticus
Pathway
cat00790  Folate biosynthesis
cat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CA2559_08636
Enzymes [BR:cat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CA2559_08636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: EAP86086
UniProt: A3UBT5
Position
1889163..1889762
Genome map
AA seq 199 aa AA seqDB search
MALYRNFEEFNIEVTDEIKSQFSSIITNLGEDVAREGIVKTPERAAKAMQFLTSGYDIDA
AEILKGAMFKEDYNDMVVVKNIELYSLCEHHMLPFFGKAHIAYIPNGHIVGLSKLPRVVD
VFARRLQVQERLTHDILECINDTLKPKGVAVVIEASHMCMMMRGVQKQNSTTTTSGFRGQ
FEAQETRNEFLKLISSDLA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcattataccgaaattttgaagaatttaatatagaagtaacagatgaaataaagtct
caattttcttctatcataactaacttaggagaagatgtagcgcgagaaggtatagtaaaa
acaccagaacgtgcagcaaaggcaatgcagtttttaacatctggatatgatatagatgct
gcagagatccttaaaggcgctatgtttaaagaggattataatgatatggttgtagtaaaa
aacattgagctttattcactttgtgaacaccatatgttaccatttttcggtaaagcccat
atagcctatatccctaatggacatattgtaggacttagtaaactaccaagagttgtagat
gtgtttgcaagacgtttacaagtgcaagaacgtttaactcacgacattttagaatgtatt
aatgatacattaaaaccaaaaggtgttgctgttgttattgaggctagccatatgtgtatg
atgatgcgtggcgtgcaaaagcaaaacagcactacaacaacatctggttttagaggacag
tttgaagctcaggagactagaaatgagtttcttaaacttattagtagcgatttagcttag

DBGET integrated database retrieval system