KEGG   Croceibacter atlanticus: CA2559_08801Help
Entry
CA2559_08801      CDS       T01256                                 

Definition
magnesium protoporphyrin chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cat  Croceibacter atlanticus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CA2559_08801
Enzymes [BR:cat01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     CA2559_08801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1928815..1930278
Genome map
AA seq 487 aa AA seqDB search
MSKENITTLGQLKASGYKSKSIKDELRDNLITNIKAGKNSFEGIHGYEYTVIPELERAIL
SKHNINLLGLRGQAKTRLARLMVGLLDEFIPVVEGSEINDDPFNPISRTAVELIAEKGDD
TPVSWLHRDERFAEKLATPDVTVADLIGDVDPIKAANLKLSYADDRVIHFGMIPRANRCI
FVINELPDLQARIQVALFNILQEGDIQIRGFKLRMPLDVQFVFTANPEDYTNRGSIVTPL
KDRIGSQILTHYPETVEIAKTITQQEAKADVRKDTVHVPEIAKNLLEELSFQARESEFVD
IKSGISARISITAYENLLSTAERRMLLSGDGTTAVRFSDFMGVIPSITGKIELVYEGEQE
GSAAVAMQLLSRATKQIFIEYFPKIEKLQKADDVDPYQNLVEWFFEESKFELLDNFANDE
YKSQLDSIQPLQALIENHIDDDVNEDDLYFIKELVLWALVEYNKLSKYRMTNGMRFKDIY
GGYISGL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagaaaatataacaacattaggccagcttaaagcttcaggctacaagtcaaaa
tcaataaaggatgagctgcgcgataacttaataacaaatataaaagcaggaaaaaattct
tttgaaggtattcacgggtatgaatatactgtaataccagaattggaacgtgcaatttta
tctaaacacaatataaatctattaggactacgcggacaggcaaaaacacgtttggcgcgt
ttaatggttggtttgttagatgaatttattcctgttgttgaaggttcagaaattaatgac
gacccatttaatcctatttcaagaactgcagtggaacttattgctgagaaaggcgatgat
acgccagtttcgtggctacatagagatgaacgttttgctgaaaaactagcaacaccagat
gtaacagtagccgatttaattggagatgtagatcctattaaagcagcaaatttaaagcta
agttatgcagatgatcgtgttattcacttcggaatgattcctcgagcaaacagatgcatt
tttgtaattaatgaattaccagatttacaagcgcgcatacaagtagcattattcaatatt
ttacaggaaggtgatattcaaattcgcggatttaaattacgcatgccgttagatgtacaa
tttgtatttacggcaaaccctgaagattatacaaatagaggaagtatcgtaactccttta
aaagatagaatagggtcacaaatactaacacattatccagaaactgttgagatagctaaa
accattacacagcaagaagctaaggcagatgtaagaaaagacaccgttcatgttcctgaa
atagctaagaatttattggaagaactatcatttcaagcaagggaaagtgagtttgtagat
ataaaaagtggcatctctgcccgaataagtataactgcttatgaaaatttactaagtaca
gcagaacgtagaatgttattatctggtgatggtaccacagcagtaagattcagtgatttt
atgggggttattcctagtattactggtaaaattgaattggtgtatgaaggtgagcaagaa
ggctctgctgcagtggcaatgcaactattgtctagagctacaaaacaaatctttattgaa
tattttcctaaaattgaaaagcttcagaaagcagatgatgtagatccctatcaaaattta
gttgaatggttttttgaagaaagtaagtttgaacttttagataattttgcaaatgatgaa
tataaatctcagttagattcaattcaacctttacaagcattaattgaaaaccatatagat
gatgatgttaatgaagatgatctgtattttataaaagaactagtcctttgggcattagta
gaatataataaacttagtaaatacagaatgacaaatggtatgcgctttaaagatatttac
ggcggttacataagtggactgtaa

DBGET integrated database retrieval system