KEGG   Croceibacter atlanticus: CA2559_09011Help
Entry
CA2559_09011      CDS       T01256                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cat  Croceibacter atlanticus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cat01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cat00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1976216..1977505)
Genome map
AA seq 429 aa AA seqDB search
MKFVSYPKIEDWQDLLKRPTQTVEDIEDTVKQIFSEVDSKGDEAIKKYTELFDGIKLNQL
EVSNLEIKESESLVSEELKQAITLAKSNIELFHKAQRTQKIEVETTQGVRCWQEKRPIQK
VGLYIPGGTAPLFSTILMLAVPALIAGCEEIVLCTPPDKKGKINPAILYTANLCGISKIY
KVGGIQAIAGMTFGTESISKVYKIFGPGNQFVTVAKQLATKFNVAIDMPAGPSELLVVAD
DTANAAFVASDLLSQAEHGKDSQVILVSTSMDLIKDVEAEISNQLKELPRKDIAEVAIKH
SKSILVKDNVEALDLINTYGPEHFIVCTKDNDFFVNGIQNAGSVFIGNYTPESAGDYASG
TNHTLPTNGYAKQYSGVNLDSFMKSMTFQEISKTGIQNIGNAIELMAEAEGLQAHKNAVT
LRLKSLDNE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgtatcctatcctaaaatagaagattggcaagacctgttaaaacgccctact
caaacggttgaagatattgaagacaccgtaaaacaaatcttttctgaggttgactctaaa
ggtgatgaagccattaaaaagtataccgaactttttgacggcattaaactaaatcaatta
gaagtttcaaacttagaaattaaggaatcagaatctcttgtttcagaagagttaaaacaa
gccattacattggcaaagtctaacatagagttatttcacaaagcacagcgtacccaaaaa
atagaagttgaaaccacgcaaggtgtacgttgttggcaagaaaaaagacctattcaaaaa
gtaggcttatatattcctggtggtacagcaccactcttttcaaccattttaatgttggct
gttcctgccttaattgcaggttgtgaggagattgtgctgtgcacgccaccagataaaaaa
ggaaagattaatcccgctattttatacaccgcaaatctttgtggcatttctaaaatttat
aaagttggtggcattcaagctattgcaggtatgacattcggtacagagtctatctcaaaa
gtttataaaatatttggtccaggaaatcaatttgtaacagtcgctaaacaattggctacc
aaatttaatgtagctatagatatgcctgcaggcccaagtgaattgttagttgttgcagat
gatactgcaaatgctgcttttgtagcttcagacttattaagccaagcagagcacggcaaa
gacagccaggttattttggtgagtacctctatggatcttataaaagatgtcgaggcagaa
atatcaaatcaacttaaagaactcccaagaaaagatattgcagaagttgctataaaacat
tcaaaatctatcttagttaaagataatgtagaagcattagatctcattaacacttatggt
ccagagcactttatagtatgtacaaaagacaatgacttttttgtaaatggtattcaaaat
gcaggctcagtatttattggaaattacacaccagaaagtgcaggagattacgcaagtggc
accaatcatacgttacctacaaatggttacgccaaacaatatagtggtgtaaacctagac
agttttatgaagagtatgacgtttcaggaaatttctaaaaccggtatccaaaacattggt
aatgctattgagcttatggcagaagcagaaggcttacaggcacacaaaaatgcggtaaca
ttacgtttaaaatctctagacaatgaataa

DBGET integrated database retrieval system