KEGG   Croceibacter atlanticus: CA2559_09198Help
Entry
CA2559_09198      CDS       T01256                                 

Definition
methylamine utilization protein/Cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cat  Croceibacter atlanticus
Brite
Enzymes [BR:cat01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CA2559_09198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2012472..2014313)
Genome map
AA seq 613 aa AA seqDB search
MQFKLYTLYFLICTIIFGTTLNYNSTSVNNDYYSTQIIEDSNAFLNATKTLDSVAQQFSA
SKSSVSNLKEQLATARHSFKRIEFYTAFKYAEFIESHINGAPLHKVSYVKNRSEIKPPEG
LQILDELIYSEDVHKEAINIASLTKKLYFSSLRLHKNVQQQHPTHSVLITALRIELIRIF
TLGISGFDTPGSLNGISETKVVLDNMSLHLNKIDKQSHHKAITHSLSILNRGATYFNETN
FENFDRLGFLKEIIDPLYKTLGDFPLDDESYSYILKSLPLNLNTTSLFDDKLLDPYFYTD
LTEKEDSELLTSLGKSLFYDTKLSTTNTVSCASCHNPKLAFTDGLPKPISFKNGDTLQRN
TPTLLNAVYANRFFYDLRAFNLEQQAEHVIFNENEFNSSYTAILNSLSKNEAYTSKFKNT
FGDTLISRERVLKALASYTSSLRSFNSSFDRYVKGESQTIPESVANGFNLFMGKANCATC
HFAPTFAGLVPPYYKDSESEVLGVLKNPRTTHKELDDDKGRITNGIHTESAWMYVNAFKT
TTVRNIEVTAPYFHNGAYKTLEEVIDFYNNGGGNGVDLNVTNQTLSEDSLNLSEAEKQDL
IAFLKSLTDTASF
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgcaattcaagctttacacactgtacttcttaatatgtaccattatttttggcaccaca
ctaaattataactcaactagtgtaaataacgactactactctactcagataattgaggac
agtaacgcgttcttaaatgcaactaaaactttggatagtgtagctcaacaatttagtgct
tctaaaagctctgtgtctaacttaaaggagcaattagctaccgcaagacattcttttaag
cgcatagagttttataccgcttttaaatatgcagagtttatagagtctcatataaatggt
gcgccattacacaaagtatcttacgtaaagaaccgttctgaaattaagccgccagaagga
ttgcaaattttagatgagctaatttacagtgaggatgttcacaaagaagccattaacatt
gcctctcttactaaaaaactttatttctccagcttaaggttacataagaatgtacaacaa
caacatcctacacattctgtactaataacagcattaagaattgaacttattagaattttt
accttgggtattagtggatttgatacgccaggatctttaaatggtataagcgagactaag
gttgtattagataatatgtcacttcatcttaataagattgataagcaatcacatcataag
gcgataactcattcattgtcgatattaaatagaggtgctacttactttaatgaaactaat
ttcgaaaattttgacagacttggttttttaaaagaaattatagatcctttatataaaaca
ttgggagattttcctttagatgacgaaagctacagctatatcttaaaatcactacccttg
aatttaaatacaacgtcattatttgatgataagttgttagatccttatttctatacagac
cttacagaaaaagaagattctgaattattaacgtctttaggtaaaagcttattttacgat
accaagttaagtacaacaaatactgtaagttgcgcatcttgccataatcctaaattggct
tttacagatggcttaccaaaacctataagctttaaaaatggagataccttacaaagaaat
acacctacattattaaatgcagtatatgctaatcgatttttctatgacttaagggctttt
aatttagaacaacaagctgagcatgttatcttcaatgaaaacgaattcaactccagttat
acagcaattcttaatagcctatcaaaaaatgaagcctacacttctaaatttaaaaacaca
tttggcgatactttaatatctagagaacgtgttttaaaagccttggcatcttatacaagt
tctctcagatcttttaatagtagttttgatcgttatgttaaaggagaatctcaaaccatt
ccagaatctgttgctaatggatttaatctgtttatgggaaaagccaattgtgctacctgt
cattttgctcctacttttgcagggttagtaccaccatactataaagattcagaaagcgaa
gtgcttggtgttttaaaaaacccaagaacaacacacaaagaactagatgatgataaaggt
agaattacaaacggcatacatactgaaagtgcttggatgtatgtaaatgcatttaaaaca
accactgtaagaaatatagaagttactgctccgtattttcataatggcgcttataaaact
ttagaagaggtcatcgatttttacaacaatggtggtggcaatggcgtagacttaaacgta
actaaccaaacactttctgaagactctctaaacctttctgaagcggaaaaacaagacctc
atcgcatttctgaaatctctaacagatactgcttcattttga

DBGET integrated database retrieval system