KEGG   Croceibacter atlanticus: CA2559_09538Help
Entry
CA2559_09538      CDS       T01256                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cat  Croceibacter atlanticus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2088408..2089049
Genome map
AA seq 213 aa AA seqDB search
MKDSHRQQGKRQQLVKIVQEKGIEDQKVLKAIGSIPRHLFMDSSFEDHAYQDKAFPIAAD
QTISQPYTVAFQTELLQIKRGDTVLEIGTGSGYQTAVLCYLGAKVYTVERQRELFKKTER
FLPKLGYRPKYATFGDGYLGLPDYAPFDKIIVTAGAPFIPKPLMQQLKVGGRLVIPVGDE
VQIMTLLERKSQKEFKKTTFGEFRFVPLLEDKN
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagattcccatagacaacaaggcaaacgccaacagctcgtaaagattgtacaagag
aaaggtattgaagaccagaaggttttaaaggccataggtagtataccaagacatttattt
atggatagtagttttgaagatcatgcctatcaagacaaagcttttcctattgctgcagac
caaaccatatctcaaccctatacagttgcttttcaaacagaacttttacaaattaaaaga
ggtgacacagttttggaaataggtacaggtagtggttatcaaactgcggtgctttgttac
ttaggtgccaaagtttacactgttgaacgccaaagagaattgtttaagaaaacagaacgc
tttcttcctaaattagggtataggccaaaatatgccacatttggagatggttatttagga
ctgccagattatgcaccatttgataagattatagttactgctggtgcaccgtttatacca
aaacctttaatgcaacagttaaaagtaggaggcaggttagttattcctgtaggagatgaa
gttcagataatgacattgttagaaagaaaaagccaaaaggagtttaagaaaaccactttt
ggcgagtttaggtttgttcctcttttggaggataaaaattaa

DBGET integrated database retrieval system