KEGG   Croceibacter atlanticus: CA2559_12308Help
Entry
CA2559_12308      CDS       T01256                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
cat  Croceibacter atlanticus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CA2559_12308
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CA2559_12308
   00630 Glyoxylate and dicarboxylate metabolism
    CA2559_12308
Enzymes [BR:cat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CA2559_12308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2670757..2672355
Genome map
AA seq 532 aa AA seqDB search
MEHTLLKLPKITYSKDVNNYYPEILTDEAHDFLAALHEKFNGERLKLLNRRLQQQSVFDN
GQFPEFPKETKEIRNTDWTAGSIPGDLQDRRVEITGPVDRKMIINALNSGAKTFMADLED
SNAPTWRNSIQGQQNLMDANKKTIKLVDTKRGKSYKLNNKTAVLLVRPRGLHLNEKNILI
NNEEASGSLVDFGLYVFHNTKTLLENGTAPYFYLPKLEHYLEARWWNEVFTFAQDYLKVP
KRTFKATVLVETITASFQLDEIIYELKDHIVGLNCGRWDYIFSYIKKFRNHPNFVVPNRD
QVTMTTPFMDAYSKLVIQRCHKRGILAIGGMAAQIPIKNNPEANAVALEKVRKDKEREVK
NGHDGTWVAHPALVEIAMTEFNKFMPTPNQLHVTRNDIHITEEDLVEIPKGTVTEAGIRK
NINVGILYTEAWLRGHGAVALYNLMEDAATAEISRTQVWQWLKNEVILEDDRKFDLTLYK
ALFNDEVEKIIKEYGESNIKNTKFELAFELFDKIVLSEKFEEFLTLSAYQYL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggaacacacgcttttaaaattaccaaaaatcacatactccaaagatgtcaataattat
tatccagaaattttaactgatgaagctcatgattttttggctgcacttcatgaaaaattt
aatggagagcgattaaaattgttaaatagacgtttacaacagcaaagtgtatttgacaac
gggcaatttccagaatttcctaaagaaacgaaagagattagaaataccgactggacagca
ggtagcattccgggcgacttacaggatagacgcgtagagattactggtcctgtcgataga
aaaatgattattaatgctttaaattctggtgccaaaacgtttatggctgacctagaagac
agcaatgcccctacttggagaaacagcattcaaggacagcaaaacttaatggatgctaat
aagaaaacaattaaattagttgacacaaaacgtgggaaatcttacaaattaaataataaa
acagctgttcttctagtaagaccaagaggcttacatttaaacgaaaagaacatattaata
aataatgaagaagcttcaggaagtttagtagattttgggttatacgtatttcacaacaca
aaaacattgttagaaaatggtacagctccttacttttatctaccaaaattagagcattat
ttagaagcacgctggtggaatgaagttttcactttcgctcaagactatttaaaagttcca
aaacgaacttttaaagcaaccgttttagtagaaacaattactgcaagttttcaattagat
gaaataatttacgagcttaaagaccatattgttggtttaaattgtggtcgttgggattac
attttctcatacatcaagaaattcagaaatcacccaaattttgtagtccctaatcgtgac
caggtaactatgacgacaccatttatggatgcttattcaaaattagtgatccagcgttgt
cataaacgtggcatacttgccattggtggtatggcagcgcaaattcctattaaaaacaat
ccagaagccaacgcggttgcgctagaaaaagttagaaaagataaagaacgtgaagtaaag
aacggtcacgatggtacttgggttgcgcatcctgctttagttgaaatagcaatgacagaa
tttaacaagtttatgccaacaccaaaccagttacacgtaacacgtaacgatatacacatc
accgaagaagatttagtagaaattccaaaaggtactgtgacagaagcaggaattagaaaa
aacattaacgtaggtattttatatacagaagcttggctaagaggacatggagctgtagca
ctatacaatttaatggaagatgctgctactgccgaaatttctagaacacaagtttggcaa
tggttaaaaaatgaagtcatacttgaagatgacagaaaatttgaccttacactctacaaa
gcgttgtttaatgatgaagttgaaaaaataataaaagagtatggcgagtctaacattaaa
aataccaagtttgaactggcgtttgagctatttgataaaatagtattgtcagaaaaattt
gaagaatttttaacgctttcagcttatcaatatctgtaa

DBGET integrated database retrieval system