KEGG   Croceibacter atlanticus: CA2559_12313Help
Entry
CA2559_12313      CDS       T01256                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
cat  Croceibacter atlanticus
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CA2559_12313
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CA2559_12313
Enzymes [BR:cat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     CA2559_12313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2672428..2674086
Genome map
AA seq 552 aa AA seqDB search
MKNLSQANYSSALQAVRNLKEKYGDTWNAIDPESAARMVTQNRFKTGLDIANYTAAIMRK
DMAEYDADSSQYTQSLGCWHGFVAQQKMIAVKKHHKTTNKKYLYLSGWMVAALRSEFGPL
PDQSMHEKTAVPALIKEIYDFLRQADAIELNDLFNRLENGEDVQDQIDNFETHIVPIIAD
IDAGFGNEEATYLLSKKMIEAGACAIQIENQVSDAKQCGHQDGKVTVPHEDFIAKLNAIR
YAFLELGVDEGIIVARTDSEGAGLTQKLPVSQEPGDLASKYLAFVETEEIAINDAKEDDV
LLKRDGKLVRPVRLANGLYKFKNGSNIDRVVLDCITNLQNGADLLWIETPTPNVKQIAHM
VNRIKDVMPNAKLVYNNSPSFNWTLNFRNQVFEEMLLEGENMTAYDRNNLMDAQYDNSEL
CYRADEKIRTFQTDSARDAGIFHHLITLPTYHTTALHMNDLTKGYFGESGMLSYVKEVQR
QEIRKGVSCVKHQRMAGSNLGDDHKTFFSGDNALKAGGEKNTSNQFEVKTDDSKVEVKFN
DHKVEVKLSVPA
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttatcacaagctaattatagttctgcactgcaagctgtaagaaaccttaaa
gaaaagtatggagatacttggaatgcaattgatccagaaagtgctgctagaatggtgact
caaaatcgttttaaaacaggtttagatattgcaaattatacggctgcaataatgagaaaa
gatatggccgagtatgatgcagattcatctcaatacacacaatcccttggttgttggcac
ggttttgttgctcagcaaaaaatgatagcagttaaaaaacatcataagaccaccaataaa
aaatacttgtacctttctggatggatggttgctgcattacgttcagaatttggaccatta
ccagatcaatctatgcatgaaaaaactgctgttccggcattaataaaagaaatttatgac
tttttaagacaagcagatgcaatagaattgaatgatttgtttaacagacttgaaaacggt
gaggatgttcaggatcaaatagacaattttgaaacacatattgtcccaatcattgcagat
atagatgcaggctttggtaatgaagaagcaacctatttactgtctaaaaaaatgatagaa
gctggagcttgcgctatccaaattgaaaatcaagtttctgatgcaaaacaatgtggacac
caagatggaaaggttacagtaccacatgaagattttatagctaaattaaatgctattagg
tatgcttttttagaattaggagtcgacgaagggatcattgtggcaagaacagattctgaa
ggtgctggccttacccaaaaactgccagttagccaagaacctggtgatttagcatctaaa
tatttagcctttgtagaaactgaagaaatagcgattaatgatgctaaagaagatgatgtg
ctgcttaaaagagatggtaaattagttcgccctgtgcgattagcaaatggtttatacaaa
tttaaaaacggctcaaatatagatagagttgtgttagattgtattacaaatcttcaaaac
ggagcagatttgttatggattgaaacacctacgcctaatgttaagcaaattgcacacatg
gtaaacagaattaaagacgttatgcctaatgcaaaattggtttacaataactcaccttct
tttaattggacattaaatttccgtaatcaagtatttgaagaaatgcttttggaaggtgaa
aacatgacagcttatgatagaaataatttaatggatgctcaatatgataattcagaacta
tgctatcgcgcagatgagaaaattagaacatttcaaacagatagtgcaagagacgccgga
attttccatcacttaatcacattgcctacatatcatacaaccgcattacacatgaatgat
cttaccaaaggttattttggagagtctggtatgttgtcttatgtaaaagaggtacaaaga
caagaaattcgcaaaggtgtatcttgcgtaaaacatcaaagaatggcaggttcaaattta
ggagacgaccataaaacattcttttctggcgataatgcactaaaggctggaggtgaaaaa
aatacttcaaatcaatttgaagttaaaactgatgatagtaaggttgaagttaaatttaat
gaccataaagtcgaagtaaaattaagtgtacctgcataa

DBGET integrated database retrieval system