KEGG   Croceibacter atlanticus: CA2559_13123Help
Entry
CA2559_13123      CDS       T01256                                 

Definition
CysQ protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cat  Croceibacter atlanticus
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cat00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CA2559_13123
Enzymes [BR:cat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CA2559_13123
Transfer RNA biogenesis [BR:cat03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CA2559_13123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2840338..2841144)
Genome map
AA seq 268 aa AA seqDB search
MNSNLEANFVVAVKASVLAGKEIMKVYQQEFEVSKKADNSPITEADNKANDCINKFLKQT
EIPIISEENEDISFEIRKHWTKCWIVDPLDGTKEFVNRNGEFTVNIALVNRGVPTFGVIY
WPVKQLLYVGDVSQNLAFRLQLINHQFSNRLLKDVKVLSPKRDHKSLKVLVSRSHASNET
KKYIDNLQKTGHPIELKSIGSSLKFCQIAEGNAHLYPRFAPTMEWDTAAGHAICNAVNIK
VMQVNSTNELEYNKENLYNPNFIVTFKQ
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtaatcttgaagcaaattttgtagtggcagttaaagcttctgttttggctggt
aaggaaattatgaaagtgtatcagcaggagtttgaagtttctaaaaaggctgataattcc
ccaattacagaggctgataataaagctaatgattgtattaataaatttttaaagcaaact
gaaataccaatcatttcagaagagaacgaagatatttcatttgagattagaaaacattgg
acaaagtgctggattgttgaccctttagacggtacaaaagaatttgtaaatagaaatgga
gaatttacggtaaacattgctttagtaaatagaggcgtgcctaccttcggtgtcatatat
tggccagttaaacaactattatatgttggtgatgtaagtcaaaatcttgcatttagacta
cagttaataaaccatcaattttctaatagattattaaaagatgtaaaggtattgtcaccg
aagagagaccataaatcgttaaaggtgttggtaagtagatcgcatgcaagcaatgaaaca
aaaaaatatatagacaatttgcaaaagacagggcatcctatcgaattaaaatctattggg
agctctcttaaattttgtcaaatcgccgagggaaacgcacatctttatcctagatttgca
ccaaccatggaatgggatactgctgcaggacatgctatttgcaacgctgtaaatatcaaa
gtaatgcaagtaaattcaacaaatgaattagagtataataaagagaatctttataatcct
aactttattgtaacatttaaacaatag

DBGET integrated database retrieval system