KEGG   Croceibacter atlanticus: CA2559_13483Help
Entry
CA2559_13483      CDS       T01256                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cat  Croceibacter atlanticus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:cat01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cat01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cat00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cat00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2918189..2918941)
Genome map
AA seq 250 aa AA seqDB search
MRKHIVAGNWKMNMDLAQTQELISSLKLQLVKETDVEILIAPPFTNLYPAFEALRETPIK
IAAQNMHQSDNGAFTGEISAKMLKSVGVKTVILGHSERRAMFHESNESLSEKVNTAIANE
MTSIFCFGEELEDRKSDNHFNVVKKQIQDGLCHINEKDWSSIVLAYEPVWAIGTGETASP
EQAQDMHKFVRNLIAEEYSDEVAQNVSILYGGSVKPNNAKEIFSQPDVDGGLIGGAALDA
VSFMQIVHSF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagcatattgtagcaggaaactggaaaatgaatatggacttagcacaaacgcag
gaactaatttcttcattaaaattacagttagtaaaagaaacagatgtagagattcttatt
gcaccacctttcactaacctttatccagcatttgaagcgttaagagaaacgccaattaag
atagctgcccaaaatatgcaccaaagtgataatggtgcctttactggagagatttctgct
aagatgctaaaaagtgtaggtgtaaaaactgttattttaggccatagtgagcgtagagct
atgttccatgagtcaaacgaaagtctttcagaaaaagtaaatacagctattgcaaacgag
atgacttcaattttctgttttggagaagaattggaagatcgtaaatcagacaatcatttt
aatgtcgtgaaaaaacaaattcaagatggtttgtgtcatattaatgaaaaagattggagt
agtattgttttagcctatgagccagtttgggcaattggtactggagagacagcctcacca
gagcaagctcaagacatgcataaatttgtaagaaacttaattgctgaagagtatagtgat
gaggtggctcaaaatgtgtccatattatatggtggtagtgttaaaccaaataatgccaaa
gaaatttttagccaaccagacgtagatggtggtcttataggtggcgcagctttagatgct
gtaagctttatgcaaattgttcactctttttaa

DBGET integrated database retrieval system