KEGG   Croceibacter atlanticus: CA2559_13483Help
Entry
CA2559_13483      CDS       T01256                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cat  Croceibacter atlanticus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CA2559_13483
   01230 Biosynthesis of amino acids
    CA2559_13483
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CA2559_13483
   00051 Fructose and mannose metabolism
    CA2559_13483
   00562 Inositol phosphate metabolism
    CA2559_13483
Enzymes [BR:cat01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CA2559_13483
Exosome [BR:cat04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CA2559_13483
  Exosomal proteins of bladder cancer cells
   CA2559_13483
  Exosomal proteins of melanoma cells
   CA2559_13483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2918189..2918941)
Genome map
AA seq 250 aa AA seqDB search
MRKHIVAGNWKMNMDLAQTQELISSLKLQLVKETDVEILIAPPFTNLYPAFEALRETPIK
IAAQNMHQSDNGAFTGEISAKMLKSVGVKTVILGHSERRAMFHESNESLSEKVNTAIANE
MTSIFCFGEELEDRKSDNHFNVVKKQIQDGLCHINEKDWSSIVLAYEPVWAIGTGETASP
EQAQDMHKFVRNLIAEEYSDEVAQNVSILYGGSVKPNNAKEIFSQPDVDGGLIGGAALDA
VSFMQIVHSF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagcatattgtagcaggaaactggaaaatgaatatggacttagcacaaacgcag
gaactaatttcttcattaaaattacagttagtaaaagaaacagatgtagagattcttatt
gcaccacctttcactaacctttatccagcatttgaagcgttaagagaaacgccaattaag
atagctgcccaaaatatgcaccaaagtgataatggtgcctttactggagagatttctgct
aagatgctaaaaagtgtaggtgtaaaaactgttattttaggccatagtgagcgtagagct
atgttccatgagtcaaacgaaagtctttcagaaaaagtaaatacagctattgcaaacgag
atgacttcaattttctgttttggagaagaattggaagatcgtaaatcagacaatcatttt
aatgtcgtgaaaaaacaaattcaagatggtttgtgtcatattaatgaaaaagattggagt
agtattgttttagcctatgagccagtttgggcaattggtactggagagacagcctcacca
gagcaagctcaagacatgcataaatttgtaagaaacttaattgctgaagagtatagtgat
gaggtggctcaaaatgtgtccatattatatggtggtagtgttaaaccaaataatgccaaa
gaaatttttagccaaccagacgtagatggtggtcttataggtggcgcagctttagatgct
gtaagctttatgcaaattgttcactctttttaa

DBGET integrated database retrieval system